Collagen VIII alpha 1 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: Collagen VIII alpha 1 Antibody [NBP2-13856] - Staining in human lung and cerebral cortex tissues using anti-COL8A1 antibody. Corresponding COL8A1 RNA-seq data more
Immunohistochemistry-Paraffin: Collagen VIII alpha 1 Antibody [NBP2-13856] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Collagen VIII alpha 1 Antibody [NBP2-13856] - Staining of human lung shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Collagen VIII alpha 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVG APVKFNKLLYNGRQNYNPQ
Specificity of human Collagen VIII alpha 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Collagen VIII alpha 1 Antibody

  • alpha-1 polypeptide
  • chromosome 3 open reading frame 7
  • collagen, type VIII, alpha 1
  • smooth muscle cell-expressed and macrophage conditioned medium-induced proteinsmag-64


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: Flow, IHC-P, IF
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Bv, Eq
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP

Publications for Collagen VIII alpha 1 Antibody (NBP2-13856) (0)

There are no publications for Collagen VIII alpha 1 Antibody (NBP2-13856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VIII alpha 1 Antibody (NBP2-13856) (0)

There are no reviews for Collagen VIII alpha 1 Antibody (NBP2-13856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Collagen VIII alpha 1 Antibody (NBP2-13856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Collagen VIII alpha 1 Products

Bioinformatics Tool for Collagen VIII alpha 1 Antibody (NBP2-13856)

Discover related pathways, diseases and genes to Collagen VIII alpha 1 Antibody (NBP2-13856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen VIII alpha 1 Antibody (NBP2-13856)

Discover more about diseases related to Collagen VIII alpha 1 Antibody (NBP2-13856).

Pathways for Collagen VIII alpha 1 Antibody (NBP2-13856)

View related products by pathway.

PTMs for Collagen VIII alpha 1 Antibody (NBP2-13856)

Learn more about PTMs related to Collagen VIII alpha 1 Antibody (NBP2-13856).

Blogs on Collagen VIII alpha 1

There are no specific blogs for Collagen VIII alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Collagen VIII alpha 1 Antibody and receive a gift card or discount.


Gene Symbol COL8A1