Collagen VIII alpha 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Collagen VIII alpha 1 Antibody [NBP2-13856] - Staining of human soft tissue shows distinct positivity in internal elastic lamina of the blood vessel.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Collagen VIII alpha 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVG APVKFNKLLYNGRQNYNPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL8A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Collagen VIII alpha 1 Protein (NBP2-13856PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen VIII alpha 1 Antibody

  • alpha-1 polypeptide
  • chromosome 3 open reading frame 7
  • collagen, type VIII, alpha 1
  • smooth muscle cell-expressed and macrophage conditioned medium-induced proteinsmag-64

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30020
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2728
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-6588
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
MAB3307
Species: Hu
Applications: WB, IP
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP

Publications for Collagen VIII alpha 1 Antibody (NBP2-13856) (0)

There are no publications for Collagen VIII alpha 1 Antibody (NBP2-13856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VIII alpha 1 Antibody (NBP2-13856) (0)

There are no reviews for Collagen VIII alpha 1 Antibody (NBP2-13856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Collagen VIII alpha 1 Antibody (NBP2-13856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen VIII alpha 1 Products

Bioinformatics Tool for Collagen VIII alpha 1 Antibody (NBP2-13856)

Discover related pathways, diseases and genes to Collagen VIII alpha 1 Antibody (NBP2-13856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen VIII alpha 1 Antibody (NBP2-13856)

Discover more about diseases related to Collagen VIII alpha 1 Antibody (NBP2-13856).
 

Pathways for Collagen VIII alpha 1 Antibody (NBP2-13856)

View related products by pathway.

PTMs for Collagen VIII alpha 1 Antibody (NBP2-13856)

Learn more about PTMs related to Collagen VIII alpha 1 Antibody (NBP2-13856).

Blogs on Collagen VIII alpha 1

There are no specific blogs for Collagen VIII alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen VIII alpha 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL8A1