Collagen VI alpha 2 Antibody

Images

 
Independent Antibodies: Western Blot: Collagen VI alpha 2 Antibody [NBP2-55655] - Analysis using Anti-COL6A2 antibody NBP2-55655 (A) shows similar pattern to independent antibody NBP1-90951 (B).
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-55655] - Staining of human liver.
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-55655] - Immunohistochemical staining of human vagina shows strong positivity in extracellular matrix and blood vessels.
Independent Antibodies: Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-55655] - Staining of human colon, kidney, liver and testis using Anti-COL6A2 antibody NBP2-55655 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-55655] - Staining of human colon.
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-55655] - Staining of human kidney.
Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP2-55655] - Staining of human testis.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Collagen VI alpha 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGTVHFAVVITDGHVTGSPCGGIKLQAERAREEGIRLFAVAPNQNLKEQGLRDIASTPHELYRNDYATMLPDSTEIDQDTINRIIKVMKHEAYGECYKVSC
Specificity
Specificity of human Collagen VI alpha 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL6A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Collagen VI alpha 2 Antibody

  • collagen alpha-2(VI) chain
  • collagen VI, alpha-2 polypeptide
  • collagen, type VI, alpha 2,10PP3610
  • DKFZp586E1322
  • FLJ46862

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6588
Species: Hu, Mu, Rt, Bv, Fe, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-594
Species: Hu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-57987
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Ze
Applications: WB
NB600-450
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Ma, Rb
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80972
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-69029
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb, Ze
Applications: WB
NBP1-59640
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-69058
Species: Hu, Mu, Rt, Bv, Eq, GP
Applications: WB, IHC
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-26551
Species: Hu, Bv, Eq
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-Fr, ICC
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow

Publications for Collagen VI alpha 2 Antibody (NBP2-55655) (0)

There are no publications for Collagen VI alpha 2 Antibody (NBP2-55655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VI alpha 2 Antibody (NBP2-55655) (0)

There are no reviews for Collagen VI alpha 2 Antibody (NBP2-55655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen VI alpha 2 Antibody (NBP2-55655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Collagen VI alpha 2 Products

Bioinformatics Tool for Collagen VI alpha 2 Antibody (NBP2-55655)

Discover related pathways, diseases and genes to Collagen VI alpha 2 Antibody (NBP2-55655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen VI alpha 2 Antibody (NBP2-55655)

Discover more about diseases related to Collagen VI alpha 2 Antibody (NBP2-55655).
 

Pathways for Collagen VI alpha 2 Antibody (NBP2-55655)

View related products by pathway.

PTMs for Collagen VI alpha 2 Antibody (NBP2-55655)

Learn more about PTMs related to Collagen VI alpha 2 Antibody (NBP2-55655).

Blogs on Collagen VI alpha 2

There are no specific blogs for Collagen VI alpha 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen VI alpha 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL6A2