COL15A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: COL15A1 Antibody [NBP1-91088] - Analysis in human placenta and liver tissues using NBP1-91088 antibody. Corresponding COL15A1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: COL15A1 Antibody [NBP1-91088] - Staining of human kidney, liver, placenta and testis using Anti-COL15A1 antibody NBP1-91088 (A) shows similar protein distribution across tissues to independent antibody NBP1-91087 (B).

Immunocytochemistry/Immunofluorescence: COL15A1 Antibody [NBP1-91088] - Staining of human cell line BJ shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: COL15A1 Antibody [NBP1-91088] - Staining of human kidney shows moderate to strong positivity in extracellular matrix.

Immunohistochemistry-Paraffin: COL15A1 Antibody [NBP1-91088] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: COL15A1 Antibody [NBP1-91088] - Staining of human placenta shows strong positivity in extracellular matrix in villi.

Immunohistochemistry-Paraffin: COL15A1 Antibody [NBP1-91088] - Staining of human testis shows strong positivity in peritubular myoid cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COL15A1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit COL15A1 Antibody - BSA Free (NBP1-91088) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL15A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  COL15A1 Protein (NBP1-91088PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for COL15A1 Antibody - BSA Free

• alpha-1 polypeptide
• COL15A1
• Collagen 15 alpha 1
• collagen alpha-1(XV) chain
• Collagen Type XV Proteoglycan
• Collagen XV alpha 1
• Collagen XV, Alpha-1 Polypeptide
• collagen, type XV, alpha 1
• Endostatin-XV
• FLJ38566
• Restin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL15A1