COL15A1 Antibody - BSA Free

Staining of human kidney shows moderate to strong positivity in extracellular matrix.

Analysis in human placenta and liver tissues. Corresponding RNA-seq data are presented for the same tissues.

Staining of human testis shows strong positivity in peritubular myoid cells.

Staining of human kidney shows moderate to strong positivity in extracellular matrix.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human placenta shows strong positivity in extracellular matrix in villi.

Staining of human kidney, liver, placenta and testis HPA017915 (A) shows similar protein distribution across tissues to independent antibody HPA017913 (B).

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COL15A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL15A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  COL15A1 Protein (NBP1-91087PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for COL15A1 Antibody - BSA Free

• alpha-1 polypeptide
• COL15A1
• Collagen 15 alpha 1
• collagen alpha-1(XV) chain
• Collagen Type XV Proteoglycan
• Collagen XV alpha 1
• Collagen XV, Alpha-1 Polypeptide
• collagen, type XV, alpha 1
• Endostatin-XV
• FLJ38566
• Restin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COL15A1 Antibody (NBP1-91087)(1)

Publication using NBP1-91087

• Kara S, Karakok M. Investigation of Gremlin 1, COL15A1 immunoreactivity and the relationship between microvessel density and Gremlin 1 in papillary renal cell carcinoma and chromophobe renal cell carcinoma. Medical Science and Discovery. 2016-01-01 (IHC-P, Human)

Bioinformatics

• Gene Symbol: COL15A1