CNTLN Antibody

Images

 
Immunohistochemistry-Paraffin: CNTLN Antibody [NBP1-88796] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNTLN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGMTEIRKIKRADPQQLRQEDSDAVWNELAYFKRENQELMIQKMNLEEELDELKVHISIDKAAIQELNRCVAERREEQLFRSGEDDEVKRSTPEKNGKEML
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNTLN Protein (NBP1-88796PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNTLN Antibody

  • bA340N12.1
  • C9orf101chromosome 9 open reading frame 101
  • C9orf39chromosome 9 open reading frame 39
  • centlein
  • centlein, centrosomal protein
  • Centrosomal protein
  • FLJ20276
  • FLJ25636
  • RP11-340N12.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-14909
Species: Hu
Applications: WB, IP
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-57371
Species: Hu
Applications: ICC/IF
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-15087
Species: Hu, Mu
Applications: WB
H00011116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CNTLN Antibody (NBP1-88796) (0)

There are no publications for CNTLN Antibody (NBP1-88796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTLN Antibody (NBP1-88796) (0)

There are no reviews for CNTLN Antibody (NBP1-88796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNTLN Antibody (NBP1-88796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNTLN Products

Bioinformatics Tool for CNTLN Antibody (NBP1-88796)

Discover related pathways, diseases and genes to CNTLN Antibody (NBP1-88796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNTLN Antibody (NBP1-88796)

Discover more about diseases related to CNTLN Antibody (NBP1-88796).

Blogs on CNTLN

There are no specific blogs for CNTLN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNTLN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTLN