Recombinant Human CNTF Protein

Product Discontinued

Recombinant Human CNTF Protein Summary

• Description: Recombinant bioactive protein containing 200 amino acids for Human CNTF
  
  

  Source:E. coli
  Amino Acid Sequence:(P26441) - AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM

• Preparation Method: Determined to be >99% pure by SDS-PAGE
• Details of Functionality: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: CNTF
• Purity: >99%, by SDS-PAGE

Applications/Dilutions

• Dilutions:
  • Bioactivity
  • SDS-Page
• Theoretical MW: 22.834 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20 to -80C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized from 0.025% NaHCO3.
• Concentration: Lyoph
• Purity: >99%, by SDS-PAGE
• Reconstitution Instructions: Centrifuge vial prior to opening. Reconstitute in sterile ddH2O or 0.4% NaHCO3 adjusted to pH 8-9 to >100 ug/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein.

Alternate Names for Recombinant Human CNTF Protein

• ciliary neurotrophic factor
• CNTF
• HCNTF

Background

CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CNTF Protein (NBP1-99451)(1)

Publication using NBP1-99451

• Yoon H, Choi CI, Triplet EM et al. Blocking the Thrombin Receptor Promotes Repair of Demyelinated Lesions in the Adult Brain J. Neurosci. 2020-01-07 [PMID: 31911460]

Bioinformatics

• Gene Symbol: CNTF