CMTM5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CMTM5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:10 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CMTM5 Antibody - BSA Free
Background
CMTM5 (CKLF-like MARVEL transmembrane domain-containing protein 5) has at least six variants from alternative splicing, CMTM5-v1 being the predominant form. Research has revealed this is widely expressed in normal tissues, but commonly silenced or down-regulated in cancer cells as a result of promoter methylation. Studies have found that expression of CMTM5-v1 in tumor cells inhibited proliferation and migration, by inducing apoptosis. Therefore, CMTM5 has tumor suppressor activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Publications for CMTM5 Antibody (NBP2-47503) (0)
There are no publications for CMTM5 Antibody (NBP2-47503).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CMTM5 Antibody (NBP2-47503) (0)
There are no reviews for CMTM5 Antibody (NBP2-47503).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CMTM5 Antibody (NBP2-47503) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CMTM5 Products
Research Areas for CMTM5 Antibody (NBP2-47503)
Find related products by research area.
|
Blogs on CMTM5