CMTM5 Antibody - BSA Free

Western Blot: CMTM5 Antibody [NBP2-47503] - Analysis in control (vector only transfected HEK293T lysate) and CMTM5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: CMTM5 Antibody [NBP2-47503] - Staining of human cell line HEL shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503] - Staining in human cerebral cortex and pancreas tissues using anti-CMTM5 antibody. Corresponding CMTM5 RNA-seq data are presented for the same tissues.

Western Blot: CMTM5 Antibody [NBP2-47503] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line HEL

Immunohistochemistry: CMTM5 Antibody [NBP2-47503] - Staining of human cerebral cortex shows neuropil positivity.

Immunohistochemistry-Paraffin: CMTM5 Antibody [NBP2-47503] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CMTM5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CMTM5 Antibody - BSA Free (NBP2-47503) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CMTM5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  CMTM5 Protein (NBP2-47503PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CMTM5 Antibody - BSA Free

• chemokine-like factor super family 5
• chemokine-like factor superfamily 5
• Chemokine-like factor superfamily member 5
• CKLF-like MARVEL transmembrane domain containing 5
• CKLF-like MARVEL transmembrane domain-containing protein 5
• CKLFSF5
• CMTM 5
• CMTM5
• FLJ37521

Background

CMTM5 (CKLF-like MARVEL transmembrane domain-containing protein 5) has at least six variants from alternative splicing, CMTM5-v1 being the predominant form. Research has revealed this is widely expressed in normal tissues, but commonly silenced or down-regulated in cancer cells as a result of promoter methylation. Studies have found that expression of CMTM5-v1 in tumor cells inhibited proliferation and migration, by inducing apoptosis. Therefore, CMTM5 has tumor suppressor activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CMTM5