Recombinant Human CMAS GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human CMAS GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-263 of Human CMAS
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CMAS
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CMAS GST (N-Term) Protein

• CMP-N-acetylneuraminic acid synthase
• CMP-N-acetylneuraminic acid synthetase
• CMP-Neu5Ac synthetase
• CMP-NeuNAc synthase
• CMP-NeuNAc synthetase
• cytidine 5'-monophosphate N-acetylneuraminic acid synthetase
• cytidine monophosphate N-acetylneuraminic acid synthetase
• EC 2.7.7.43
• N-acylneuraminate cytidylyltransferase

Background

The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CMAS