CLOCK Antibody (3D8H6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CLOCK (NP_004889.1). WKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CLOCK |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CLOCK Antibody (3D8H6)
Background
Circadian Locomotor Output Cycles Kaput (CLOCK) is a bHLH/PAS protein that plays an important role in the molecular clock mechanism. Specifically, CLOCK activates the central circadian loop by stimulating expression of Period and Timeless proteins. CLOCK has also been shown to interact strongly with other bHLH-PAS proteins such as MOP3, a BMAL1 isoform.
CLOCK levels peak during the late night and the early part of the subjective day. Mutations in CLOCK causes defective transcriptional activity and lengthens the circadian period, leading to abnormal circadian behavior.
CLOCK antibodies are useful tools for research on circadian rythmns, sleep biology and hormonal cycles.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for CLOCK Antibody (NBP3-16656) (0)
There are no publications for CLOCK Antibody (NBP3-16656).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CLOCK Antibody (NBP3-16656) (0)
There are no reviews for CLOCK Antibody (NBP3-16656).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CLOCK Antibody (NBP3-16656) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CLOCK Products
Research Areas for CLOCK Antibody (NBP3-16656)
Find related products by research area.
|
Blogs on CLOCK