PER3 Antibody

Images

 
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human placenta shows strong positivity in erythrocytes.
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PER3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QPVHVSVSSGYGSLGSSGSQEQLVSIASSSEASGHRVEETKAEQMTLQQVYASVNKIKNLGQQLYIESMTKSSFKPVTGTRTEPNGGGESANGGGECKTFTSFHQTLKNNSVYTEPCEDLRNDEHSPSYQQIN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PER3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PER3 Protein (NBP1-86436PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PER3 Antibody

  • Cell growth-inhibiting gene 13 protein
  • Circadian clock protein PERIOD 3
  • GIG13
  • growth-inhibiting protein 13
  • hPER3
  • period (Drosophila) homolog 3
  • period 3
  • period circadian protein 3
  • period circadian protein homolog 3
  • period homolog 3 (Drosophila)

Background

PER3 is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-125
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-126
Species: Hu, Mu
Applications: ChIP, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NB100-40853
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
210-TA
Species: Hu
Applications: BA
NBP1-86436
Species: Hu
Applications: IHC, IHC-P

Publications for PER3 Antibody (NBP1-86436) (0)

There are no publications for PER3 Antibody (NBP1-86436).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PER3 Antibody (NBP1-86436) (0)

There are no reviews for PER3 Antibody (NBP1-86436). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PER3 Antibody (NBP1-86436) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PER3 Products

Bioinformatics Tool for PER3 Antibody (NBP1-86436)

Discover related pathways, diseases and genes to PER3 Antibody (NBP1-86436). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PER3 Antibody (NBP1-86436)

Discover more about diseases related to PER3 Antibody (NBP1-86436).
 

Pathways for PER3 Antibody (NBP1-86436)

View related products by pathway.

PTMs for PER3 Antibody (NBP1-86436)

Learn more about PTMs related to PER3 Antibody (NBP1-86436).
 

Research Areas for PER3 Antibody (NBP1-86436)

Find related products by research area.

Blogs on PER3

There are no specific blogs for PER3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PER3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PER3