CLIP4 Antibody

Images

 
Western Blot: CLIP4 Antibody [NBP2-55452] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: CLIP4 Antibody [NBP2-55452] - Staining of human cell line HeLa shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLIP4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRVQRVTDSLDTLSEISSNKQNHSYPGFRRSFSTTSASSQKEINRRNAFSKSKAALRRSWSSTPTAGGIEGSVKLHEGSQVLLTSSNEMGTV
Specificity
Specificity of human CLIP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLIP4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CLIP4 Antibody

  • CAP-GLY domain containing linker protein family, member 4
  • CAP-Gly domain-containing linker protein 4
  • FLJ21069
  • FLJ32705
  • restin-like 2
  • Restin-like protein 2
  • RSNL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20763
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-55249
Species: Hu, Mu
Applications: WB, IP
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, KO
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
NB400-116
Species: Hu, Mk
Applications: WB, ICC/IF, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15972
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
MAB342
Species: Hu
Applications: WB, AgAct
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-90201
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55452
Species: Hu
Applications: WB, ICC/IF

Publications for CLIP4 Antibody (NBP2-55452) (0)

There are no publications for CLIP4 Antibody (NBP2-55452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIP4 Antibody (NBP2-55452) (0)

There are no reviews for CLIP4 Antibody (NBP2-55452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLIP4 Antibody (NBP2-55452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CLIP4 Products

Bioinformatics Tool for CLIP4 Antibody (NBP2-55452)

Discover related pathways, diseases and genes to CLIP4 Antibody (NBP2-55452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIP4 Antibody (NBP2-55452)

Discover more about diseases related to CLIP4 Antibody (NBP2-55452).
 

Pathways for CLIP4 Antibody (NBP2-55452)

View related products by pathway.

PTMs for CLIP4 Antibody (NBP2-55452)

Learn more about PTMs related to CLIP4 Antibody (NBP2-55452).

Blogs on CLIP4

There are no specific blogs for CLIP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIP4