CLCN5 Antibody

Images

 
Immunohistochemistry-Paraffin: CLCN5 Antibody [NBP1-84451] - Staining of human cerebral cortex shows moderate granular positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLCN5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLCN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLCN5 Protein (NBP1-84451PEP)
Publications
Read Publication using NBP1-84451.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23029130)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLCN5 Antibody

  • chloride channel 5
  • Chloride channel protein 5
  • Chloride transporter ClC-5
  • CLC5
  • clC-5
  • CLCK2NPHL2
  • DENTSNPHL1
  • H(+)/Cl(-) exchange transporter 5
  • hCIC-K2
  • hClC-K2
  • nephrolithiasis 1 (X-linked)
  • nephrolithiasis 2, X-linked
  • XLRH
  • XRN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30066
Species: Hu
Applications: WB, ICC/IF, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30021
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001188-P01
Species: Hu
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC
NBP2-35213
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001185-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46842
Species: Hu
Applications: IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84451
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CLCN5 Antibody (NBP1-84451)(1)

Reviews for CLCN5 Antibody (NBP1-84451) (0)

There are no reviews for CLCN5 Antibody (NBP1-84451). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CLCN5 Antibody (NBP1-84451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLCN5 Products

Bioinformatics Tool for CLCN5 Antibody (NBP1-84451)

Discover related pathways, diseases and genes to CLCN5 Antibody (NBP1-84451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCN5 Antibody (NBP1-84451)

Discover more about diseases related to CLCN5 Antibody (NBP1-84451).
 

Pathways for CLCN5 Antibody (NBP1-84451)

View related products by pathway.

PTMs for CLCN5 Antibody (NBP1-84451)

Learn more about PTMs related to CLCN5 Antibody (NBP1-84451).

Blogs on CLCN5

There are no specific blogs for CLCN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCN5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCN5