CLCN1 Antibody

Images

 
Western Blot: CLCN1 Antibody [NBP1-69124] - Lanes: 1: 20 ug mouse muscle membrane fraction, 2: Empty, 3: 20 ug mouse brain membrane fraction, 4: Empty, 5: 20 ug mouse muscle cytosolic fraction, 6: 20 ug mouse brain ...read more
Western Blot: CLCN1 Antibody [NBP1-69124] - Rat Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLCN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLCN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against Clcn1 and was validated on Western blot.
Theoretical MW
110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CLCN1 Antibody

  • chloride channel 1, skeletal muscle
  • Chloride channel protein, skeletal muscle
  • clC-1
  • CLC1chloride channel protein 1
  • MGC138361
  • MGC142055

Background

Clcn1 is the voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006329-R01
Species: Hu
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-69123
Species: Hu, Mu, Rt
Applications: WB
NBP2-30021
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP1-91790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30066
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00001188-P01
Species: Hu
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001185-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46842
Species: Hu
Applications: IHC, IHC-P
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC

Publications for CLCN1 Antibody (NBP1-69124) (0)

There are no publications for CLCN1 Antibody (NBP1-69124).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN1 Antibody (NBP1-69124) (0)

There are no reviews for CLCN1 Antibody (NBP1-69124). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCN1 Antibody (NBP1-69124) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLCN1 Products

Bioinformatics Tool for CLCN1 Antibody (NBP1-69124)

Discover related pathways, diseases and genes to CLCN1 Antibody (NBP1-69124). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCN1 Antibody (NBP1-69124)

Discover more about diseases related to CLCN1 Antibody (NBP1-69124).
 

Pathways for CLCN1 Antibody (NBP1-69124)

View related products by pathway.

Blogs on CLCN1

There are no specific blogs for CLCN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCN1