Claudin-12 Antibody - BSA Free

Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 and decreased CLDN-12 expression in the cortex of ASD subjects. a Brain tissues were lysed and immunoblotted with anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression and are expressed as the mean +/- standard error. Quantitative results represent the average of three independent experiments. ****p < 0.0001. Image collected and cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: Claudin-12 Antibody [NBP1-87450] - Staining of human pancreas shows moderate cytoplasmic and membranous positivity in exocrine glandular cells along with moderate cytoplasmic staining in islets of Langerhans

Western Blot: Claudin-12 Antibody [NBP1-87450] - Analysis in human liver tissue.

Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 expression in the cerebellum of ASD subjects. a Western blots of brain lysates immunoblotted with anti-claudin-5, anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression & are expressed as the mean ± standard error. Quantitative results represent the average of three independent experiments. ***p < 0.001 Image collected & cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: Claudin-12 Antibody [NBP1-87450] - Increased CLDN-5 & decreased CLDN-12 expression in the cortex of ASD subjects. a Brain tissues were lysed & immunoblotted with anti-claudin-5, anti-claudin-12, SMA or actin antibody. b Densitometry analysis of the results from the western blots is shown, where the data are normalized against SMA expression & are expressed as the mean ± standard error. Quantitative results represent the average of three independent experiments.*p < 0.05; ****p < 0.0001 Image collected & cropped by CiteAb from the following publication (//molecularautism.biomedcentral.com/articles/10.1186/s13229-016-0110-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Claudin-12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Claudin-12 Antibody - BSA Free (NBP1-87450) is a polyclonal antibody validated for use in IHC and WB. Anti-Claudin-12 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 29986305). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Claudin-12 Protein (NBP1-87450PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Claudin-12 Antibody - BSA Free

• claudin 12
• Claudin12
• Claudin-12
• CLDN12

Background

Claudins, such as CLDN12, are components of epithelial cell tight junctions. Tight junctions regulate movement ofsolutes and ions through the paracellular space and prevent mixing of proteins and lipids in the outer leaflet of theapical and basolateral plasma membrane domains (Acharya et al., 2004).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Claudin-12 Antibody (NBP1-87450)(3)

Publications using NBP1-87450

• Zhang Y, Qiao Z, Yu J et Al. Effects of Dietary Colostrum Basic Protein on Bone Growth and Calcium Absorption in Mice Nutrients 2024-02-27 [PMID: 38474792]
• GaffneY-Stomberg E, Marszewski P, MacArthur M et al. Paracellular calcium flux across Caco-2 cell monolayers: Effects of individual amino acids. J. Nutr. Biochem. 2018-07-05 [PMID: 29986305] (WB, Human)
• Fiorentino M, Sapone A, Senger S et al. Blood-brain barrier and intestinal epithelial barrier alterations in autism spectrum disorders Mol Autism. 2016-11-28 [PMID: 27957319] (WB, Human)

Bioinformatics

• Gene Symbol: CLDN12