Claudin-12 Antibody

Images

 
Western Blot: Claudin-12 Antibody [NBP1-87450] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: Claudin-12 Antibody [NBP1-87450] - Staining of human pancreas shows moderate cytoplasmic and membranous positivity in exocrine glandular cells along with moderate cytoplasmic staining in ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Claudin-12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLDN12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Bladder Lysate (NB820-59467)
Control Peptide
Claudin-12 Protein (NBP1-87450PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Claudin-12 Antibody

  • claudin 12
  • Claudin12
  • Claudin-12
  • CLDN12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB5275
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
NBP1-60010
Species: Hu
Applications: WB, IHC, IHC-P
MAB4280
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NB100-1070
Species: Hu, Mu
Applications: WB, ELISA
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
AF3320
Species: Hu
Applications: WB, IHC
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87450
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for Claudin-12 Antibody (NBP1-87450) (0)

There are no publications for Claudin-12 Antibody (NBP1-87450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-12 Antibody (NBP1-87450) (0)

There are no reviews for Claudin-12 Antibody (NBP1-87450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-12 Antibody (NBP1-87450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Claudin-12 Products

Bioinformatics Tool for Claudin-12 Antibody (NBP1-87450)

Discover related pathways, diseases and genes to Claudin-12 Antibody (NBP1-87450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-12 Antibody (NBP1-87450)

Discover more about diseases related to Claudin-12 Antibody (NBP1-87450).
 

Pathways for Claudin-12 Antibody (NBP1-87450)

View related products by pathway.

PTMs for Claudin-12 Antibody (NBP1-87450)

Learn more about PTMs related to Claudin-12 Antibody (NBP1-87450).

Blogs on Claudin-12

There are no specific blogs for Claudin-12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN12
Entrez