Claudin-19 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Claudin-19 Antibody - BSA Free (NBP3-24745) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein Claudin-19 using the following amino acid sequence: GDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLL |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CLDN19 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Claudin-19 Antibody - BSA Free
Background
The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliterationof the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause ofhypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primaryrenal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocularabnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Twotranscript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Ca, Hu
Applications: , WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for Claudin-19 Antibody (NBP3-24745) (0)
There are no publications for Claudin-19 Antibody (NBP3-24745).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Claudin-19 Antibody (NBP3-24745) (0)
There are no reviews for Claudin-19 Antibody (NBP3-24745).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Claudin-19 Antibody (NBP3-24745) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Claudin-19 Products
Research Areas for Claudin-19 Antibody (NBP3-24745)
Find related products by research area.
|
Blogs on Claudin-19