Claudin-11 Antibody - BSA Free

Immunohistochemistry-Paraffin: Claudin-11 Antibody [NBP3-10304] - Immunohistochemcal analysis of formalin-fixed paraffin-embedded human brain, cortex, white matter tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Claudin-11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Claudin-11 Antibody - BSA Free (NBP3-10304) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Claudin-11 (NP_005593). Peptide sequence VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Claudin-11 Antibody - BSA Free

• claudin 11
• Claudin11
• Claudin-11
• CLDN11
• Oligodendrocyte-specific protein
• OSP
• OSPOTMoligodendrocyte transmembrane protein
• OTM

Background

Oligodendrocyte specific protein belongs is a major component of central nervous system myelin that is necessary for normal CNS function. The claudin superfamily consists of many structurally related proteins in humans. These proteins, which include claudin 1 through 18, and are located in both epithelial and endothelial cells in all tight junction bearing tissues. Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. There is growing evidence that the Claudin 11 protein determines the permeability between layers of myelin sheaths via focal adhesion and with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLDN11