Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) Summary
| Description |
Novus Biologicals Rabbit Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) (NBP3-16518) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin Heavy Chain 1/CHC17 (Q00610). SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CLTC |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
- Immunohistochemistry 1:200 - 1:2000
- Immunohistochemistry-Paraffin 1:200 - 1:2000
- Immunoprecipitation 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
191 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)
Background
Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains (192 kDa) and three light chains (LCa or LCb, 25-29 kDa) and self assembles into a polyhedral cytoskeletal element. Self assembly facilitates clathrin's central role in membrane sorting and selective transport within the cell.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: BA
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Publications for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518) (0)
There are no publications for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518) (0)
There are no reviews for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Clathrin Heavy Chain 1/CHC17 Products
Research Areas for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518)
Find related products by research area.
|
Blogs on Clathrin Heavy Chain 1/CHC17