Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Analysis of extracts of various cell lines, using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunoprecipitation: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Analysis of 300ug extracts of NIH/3T3 cells using 3ug Clathrin Heavy Chain 1/CHC17 antibody (NBP3-16518). Western blot was performed from the immunoprecipitate using Clathrin Heavy Chain 1/CHC17 antibody (NBP3-16518) at a dilition of 1:1000.

Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Confocal imaging of HeLa cells using Clathrin heavy chain Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with alpha -Tubulin Rabbit mAb (dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] -Human colon carcinoma tissue using Clathrin heavy chain Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Human colon tissue using Clathrin heavy chain Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] -Human thyroid cancer tissue using Clathrin heavy chain Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Confocal imaging of HeLa cells using Clathrin Heavy Chain 1/CHC17 Rabbit mAb . The cells were counterstained with alpha-Tubulin Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [Clathrin Heavy Chain 1/CHC17] - Confocal imaging of HeLa cells using Clathrin Heavy Chain 1/CHC17 Rabbit mAb . The cells were counterstained with alpha-Tubulin Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clone: 9M2G2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin Heavy Chain 1/CHC17 (Q00610). SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CLTC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Immunoprecipitation 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 191 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

• CHC
• CHC17
• Clathrin Heavy Chain 1
• Clathrin heavy chain on chromosome 17
• clathrin, heavy chain (Hc)
• clathrin, heavy chain
• clathrin, heavy polypeptide (Hc)
• clathrin, heavy polypeptide-like 2
• CLH17
• CLH-17
• CLTC
• CLTCL2
• Hc
• KIAA0034

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains (192 kDa) and three light chains (LCa or LCb, 25-29 kDa) and self assembles into a polyhedral cytoskeletal element. Self assembly facilitates clathrin's central role in membrane sorting and selective transport within the cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLTC