CKAP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CKAP2 Antibody [NBP1-84602] - Staining of human cell line U-2 OS shows localization to cytosol & microtubules.

Analysis in human testis and pancreas tissues using HPA008410 antibody. Corresponding CKAP2 RNA-seq data are presented for the same tissues.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human tonsil shows moderate membranous cytoplasmic positivity in germinal center cells.

Analysis in human cell line HEK 293.

Staining of human kidney shows cytoplasmic positivity in cells in tubules.

Staining of human testis shows strong membranous cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKAP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CKAP2 Antibody - BSA Free (NBP1-84602) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CKAP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CKAP2 Protein (NBP1-84602PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CKAP2 Antibody - BSA Free

• CTCL tumor antigen se20-10
• cytoskeleton associated protein 2
• cytoskeleton-associated protein 2
• LB1DKFZp686L1238
• se20-10
• TMAPFLJ10749
• Tumor- and microtubule-associated protein
• tumor-associated microtubule-associated protein

Background

CKAP2 (cytoskeletal-associated protein 2), also known as TMAP (tumor-associated microtubule-associated protein), was identified as an mRNA up-regulated in primary human gastric cancers. It was found to localize to microtubule organizing centers and microtubules and play a role in cell division. CKAP2 is required for proper chromosome segregation and the maintenance of genomic stability. It has recently been shown to be a substrate of Cdk1-cyclinB and essential for bipolar spindle formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKAP2