CKAP1 Antibody - BSA Free

Immunohistochemistry: CKAP1 Antibody [NBP3-35326] - Immunohistochemistry analysis of paraffin-embedded Rat brain using CKAP1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: CKAP1 Antibody [NBP3-35326] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using CKAP1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: CKAP1 Antibody [NBP3-35326] - Immunohistochemistry analysis of paraffin-embedded Human placenta using CKAP1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: CKAP1 Antibody [NBP3-35326] - Western blot analysis of various lysates using CKAP1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CKAP1 Antibody - BSA Free (NBP3-35326) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human CKAP1 (NP_001272.2).
  
  Sequence:
  MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBCB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for CKAP1 Antibody - BSA Free

• CG22Tubulin-specific chaperone B
• CKAP1MGC14625
• CKAPI
• cytoskeleton associated protein 1
• Cytoskeleton-associated protein 1Cytoskeleton-associated protein CKAPI
• tubulin folding cofactor B
• tubulin-folding cofactor B

Background

CKAP1 binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathwayleading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimerdissociation. May function as

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBCB