Citron Kinase Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Citron Kinase Antibody [NBP2-57994] - Citron Antibody [NBP2-57994] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Citron Kinase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ERSDLEYQLENIQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNELKLALEKEKARCA
Specificity
Specificity of human Citron antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CIT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Citron Kinase Recombinant Protein Antigen (NBP2-57994PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Citron Kinase Antibody

  • CITK
  • citron (rho-interacting, serine/threonine kinase 21)
  • Citron Rho-Interacting Kinase
  • Citron Rho-Interacting Serine/Threonine Kinase
  • CRIK
  • KIAA0949
  • MCPH17
  • Rho-interacting Serine/Threonine kinase 21
  • serine/threonine kinase 21
  • Serine/threonine-protein kinase 21
  • STK21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Citron Kinase Antibody (NBP2-57994) (0)

There are no publications for Citron Kinase Antibody (NBP2-57994).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Citron Kinase Antibody (NBP2-57994) (0)

There are no reviews for Citron Kinase Antibody (NBP2-57994). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Citron Kinase Antibody (NBP2-57994) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Citron Kinase Products

Bioinformatics Tool for Citron Kinase Antibody (NBP2-57994)

Discover related pathways, diseases and genes to Citron Kinase Antibody (NBP2-57994). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Citron Kinase Antibody (NBP2-57994)

Discover more about diseases related to Citron Kinase Antibody (NBP2-57994).
 

Pathways for Citron Kinase Antibody (NBP2-57994)

View related products by pathway.

PTMs for Citron Kinase Antibody (NBP2-57994)

Learn more about PTMs related to Citron Kinase Antibody (NBP2-57994).
 

Research Areas for Citron Kinase Antibody (NBP2-57994)

Find related products by research area.

Blogs on Citron Kinase

There are no specific blogs for Citron Kinase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Citron Kinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CIT