CITED1 Antibody (6C8)

Images

 
Western Blot: CITED1 Antibody (6C8) [H00004435-M05] - Analysis of CITED1 expression in PC-12 (Cat # L012V1).
Western Blot: CITED1 Antibody (6C8) [H00004435-M05] - Analysis of CITED1 expression in A-431 (Cat # L015V1).
Sandwich ELISA: CITED1 Antibody (6C8) [H00004435-M05] - Detection limit for recombinant GST tagged CITED1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
6C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CITED1 Antibody (6C8) Summary

Immunogen
CITED1 (NP_004134, 94 a.a. - 193 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Specificity
CITED1 - Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (6C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CITED1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CITED1 Antibody (6C8)

  • cbp/p300-interacting transactivator 1
  • Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1
  • melanocyte-specific gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00010736-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi, RNAi SP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC

Publications for CITED1 Antibody (H00004435-M05) (0)

There are no publications for CITED1 Antibody (H00004435-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CITED1 Antibody (H00004435-M05) (0)

There are no reviews for CITED1 Antibody (H00004435-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CITED1 Antibody (H00004435-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CITED1 Products

Bioinformatics Tool for CITED1 Antibody (H00004435-M05)

Discover related pathways, diseases and genes to CITED1 Antibody (H00004435-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CITED1 Antibody (H00004435-M05)

Discover more about diseases related to CITED1 Antibody (H00004435-M05).
 

Pathways for CITED1 Antibody (H00004435-M05)

View related products by pathway.

PTMs for CITED1 Antibody (H00004435-M05)

Learn more about PTMs related to CITED1 Antibody (H00004435-M05).

Blogs on CITED1

There are no specific blogs for CITED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CITED1 Antibody (6C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CITED1
Entrez
Uniprot