![Immunocytochemistry/Immunofluorescence: CIP2A Antibody [NBP2-48710] - Analysis of human cell line A-431 shows positivity in plasma membrane & cytoplasm.](http://images.novusbio.com/fullsize/CIP2A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-48710-img0001.jpg "Immunocytochemistry/Immunofluorescence: CIP2A Antibody [NBP2-48710] - Analysis of human cell line A-431 shows positivity in plasma membrane & cytoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CIP2A Antibody - BSA Free (NBP2-48710) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-CIP2A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KMPWQSSNHSFPTSIKCLTPHLKDGVPGLNIEELIEKLQSGMVVKDQICDVRISDIMDVYEMKLSTLASKESRLQDLLETKALALAQADRLIAQHRCQRTQAET |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CIP2A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP2-48710 | Applications | Species |
|---|---|---|
| Hung KL, Jones MG, Wong IT et Al. Coordinated inheritance of extrachromosomal DNAs in cancer cells Nature 2024-11-06 [PMID: 39506152] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CIP2A Antibody (NBP2-48710)Find related products by research area.
|
|
CIP2A - A lean, mean, oncoprotein machine The CIP2A protein was originally identified as p90, a cytoplasmic auto-antigen from the serum of a cancer patient. It was later found to inhibit protein phosphatase 2A (PP2A) activity as well as interact with c-myc. CIP2A's inhibitory activity blocks ... Read full blog post. |
|
CIP2A: The Cancerous Inhibitor of Protein Phosphatase 2A The autoantigen p90 is a recently discovered protein that binds to and inhibits Protein Phosphatase 2A (PP2A) activity, thereby playing a critical role in cancer progression. Thus, p90 was renamed the "cancerous inhibitory protein of PP2A" or CIP2A.... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CIP2A |
![Immunohistochemistry-Paraffin: CIP2A Antibody [NBP2-48710] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CIP2A-Antibody-Immunohistochemistry-Paraffin-NBP2-48710-img0003.jpg "Immunohistochemistry-Paraffin: CIP2A Antibody [NBP2-48710] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunocytochemistry RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Immunocytochemistry_15894.jpg)
![Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/16242.jpg)
![Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Western_Blot_14193.jpg)
![Western Blot Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]](https://images.novusbio.com/images2/Ribosomal_Protein_S6_AF3918_Western_Blot_5362.jpg)
![Simple Western Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]](https://images.novusbio.com/images2/16338.jpg)
![Immunohistochemistry Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]](https://images.novusbio.com/images2/Ribosomal_Protein_S6_AF3918_Immunohistochemistry_6813.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Immunocytochemistry__Immunofluorescence_21057.jpg)
![Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Simple_Western_16621.jpg)
![Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_gamma_AF1347_Western_Blot_12767.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")