Recombinant Human CIDEC Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CIDEC Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-238 of Human CIDEC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CIDEC
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CIDEC Protein

  • cell death activator CIDE-3
  • cell death-inducing DFFA-like effector c
  • Cell death-inducing DFFA-like effector protein C
  • CIDE-3
  • CIDEC
  • CIDEX
  • Fat-specific protein FSP27 homolog
  • FLJ20871
  • FSP27
  • FSP27fat specific protein 27

Background

CIDEC( AAH16851, 1 a.a. - 239 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76950
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-55757
Species: Mu
Applications: WB
NB110-40760
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB120-13592
Species: Hu
Applications: WB
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00063924-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CIDEC Recombinant Protein (H00063924-P01) (0)

There are no publications for CIDEC Recombinant Protein (H00063924-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIDEC Recombinant Protein (H00063924-P01) (0)

There are no reviews for CIDEC Recombinant Protein (H00063924-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIDEC Recombinant Protein (H00063924-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CIDEC Products

Bioinformatics Tool for CIDEC Recombinant Protein (H00063924-P01)

Discover related pathways, diseases and genes to CIDEC Recombinant Protein (H00063924-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIDEC Recombinant Protein (H00063924-P01)

Discover more about diseases related to CIDEC Recombinant Protein (H00063924-P01).
 

Pathways for CIDEC Recombinant Protein (H00063924-P01)

View related products by pathway.

PTMs for CIDEC Recombinant Protein (H00063924-P01)

Learn more about PTMs related to CIDEC Recombinant Protein (H00063924-P01).
 

Research Areas for CIDEC Recombinant Protein (H00063924-P01)

Find related products by research area.

Blogs on CIDEC

There are no specific blogs for CIDEC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CIDEC Antibody
NB100-430

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CIDEC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CIDEC
Entrez