CIDEA Antibody (4B9) - Azide and BSA Free

Western Blot: CIDEA Antibody (4B9) [H00001149-M01] - Analysis of CIDEA expression in transfected 293T cell line by CIDEA monoclonal antibody (M01), clone 4B9.Lane 1: CIDEA transfected lysate(28.3 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: CIDEA Antibody (4B9) [H00001149-M01] - Analysis of CIDEA transfected lysate using anti-CIDEA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CIDEA MaxPab rabbit polyclonal antibody.

ELISA: CIDEA Antibody (4B9) [H00001149-M01] - Detection limit for recombinant GST tagged CIDEA is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, IP
• Clone: 4B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CIDEA Antibody (4B9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CIDEA (AAH31896, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
• Specificity: CIDEA - cell death-inducing DFFA-like effector a
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CIDEA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. Use in Immunohistochemistry reported in scientific literature (PMID: 30089732).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CIDEA Antibody (4B9) - Azide and BSA Free

• cell death activator CIDE-A
• cell death-inducing DFFA-like effector aCIDE-A
• CIDEA

Background

This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Two alternative transcripts encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CIDEA Antibody (H00001149-M01)(9)

Publications using H00001149-M01

• Yusuke A, Kazutaka U, Seitaro N et al. Beiging of perivascular adipose tissue regulates its inflammation and vascular remodeling. Nat Commun. 2022-09-07 [PMID: 36071032]
• Finlin BS, Memetimin H, Zhu B et al. Pioglitazone does not synergize with mirabegron to increase beige fat or further improve glucose metabolism JCI insight 2021-02-11 [PMID: 33571166] (IF/IHC, Human)
• Finlin BS, Memetimin H, Confides AL et al. Human adipose beiging in response to cold and mirabegron. JCI Insight 2018-08-09 [PMID: 30089732] (IF/IHC, Human)
  
  Details:
  This citation used the Alexa Fluor 488 version of this antibody.
• Wang-Johanning F, Rycaj K, Plummer JB et al. Immunotherapeutic Potential of Anti-Human Endogenous Retrovirus-K Envelope Protein Antibodies in Targeting Breast Tumors. J Natl Cancer Inst. 2012-01-12 [PMID: 22247020]
• Ito M, Nagasawa M, Omae N et al. Differential regulation of CIDEA and CIDEC expression by insulin via Akt1/2- and JNK2-dependent pathways in human adipocytes. J Lipid Res. 2011-06-02 [PMID: 21636835]
• Pulinilkunnil T, He H, Kong D et al. Adrenergic regulation of AMP-activated protein kinase in brown adipose tissue in vivo. J Biol Chem. 2011-03-18 [PMID: 21209093]
  
  Details:
  WB: GAPDH Loading Control (IMG-3073). Mouse interscapular brown adipose cells, Fig 3A.
• Ito M, Nagasawa M, Hara T et al. Differential roles of CIDEA and CIDEC in insulin-induced anti-apoptosis and lipid droplet formation in human adipocytes. J Lipid Res;51(7):1676-84. 2010-07-01 [PMID: 20154362]
• Xue B, Pulinilkunnil T, Murano I et al. Neuronal Protein Tyrosine Phosphatase 1B Deficiency Results in Inhibition of Hypothalamic AMPK Isoform-Specific Activation of AMPK in Peripheral Tissues. Mol Cell Biol;29(16):4563-4573. 2009-01-01 [PMID: 19528236]
• Puri V et al. Cidea is associated with lipid droplets and insulin sensitivity in humans. Proc Natl Acad Sci U S A;105(22):7833-8. 2008-06-03 [PMID: 18509062]

Bioinformatics

• Gene Symbol: CIDEA
• Entrez:
  • 1149(Human)
• OMIM:
  • 604440(Human)
• Uniprot:
  • AAH31896(Human)