| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit cIAP-1/HIAP-2 Antibody - BSA Free (NBP1-90133) is a polyclonal antibody validated for use in IHC and WB. Anti-cIAP-1/HIAP-2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BIRC2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-90133 | Applications | Species |
|---|---|---|
| Werner TA, Nolten I, Dizdar L et al. IAPs cause resistance to TRAIL-dependent apoptosis in follicular thyroid cancer Endocr. Relat. Cancer 2018-01-09 [PMID: 29317481] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for cIAP-1/HIAP-2 Antibody (NBP1-90133)Find related products by research area.
|
|
Read full blog post. |
|
cIAP1 - An apoptotic regulator with implications in drug resistant cancers Cellular inhibitor of apoptosis protein-1 (cIAP-1) is an anti-apoptotic protein that is able to bind to caspases and inhibit their activity. Additionally cIAP-1 contains a RING domain with E3 ubiquitin ligase activity that is able to mediate the r... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BIRC2 |