cIAP-1/HIAP-2 Antibody

Images

 
Western Blot: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma ...read more
Immunohistochemistry-Paraffin: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Western Blot: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

cIAP-1/HIAP-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BIRC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
cIAP-1/HIAP-2 Protein (NBP1-90133PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for cIAP-1/HIAP-2 Antibody

  • API1Hiap-2
  • apoptosis inhibitor 1
  • baculoviral IAP repeat containing 2
  • baculoviral IAP repeat-containing 2
  • baculoviral IAP repeat-containing protein 2
  • BIRC2
  • cIAP1
  • c-IAP1
  • cIAP-1
  • hIAP2
  • HIAP-2
  • IAP homolog B
  • IAP2
  • IAP-2
  • Inhibitor of apoptosis protein 2
  • MIHB
  • MIHBHIAP2
  • NFR2-TRAF signalling complex protein
  • RING finger protein 48
  • RNF48hiap-2
  • TNFR2-TRAF-signaling complex protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-90133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for cIAP-1/HIAP-2 Antibody (NBP1-90133) (0)

There are no publications for cIAP-1/HIAP-2 Antibody (NBP1-90133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cIAP-1/HIAP-2 Antibody (NBP1-90133) (0)

There are no reviews for cIAP-1/HIAP-2 Antibody (NBP1-90133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for cIAP-1/HIAP-2 Antibody (NBP1-90133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cIAP-1/HIAP-2 Products

Bioinformatics Tool for cIAP-1/HIAP-2 Antibody (NBP1-90133)

Discover related pathways, diseases and genes to cIAP-1/HIAP-2 Antibody (NBP1-90133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cIAP-1/HIAP-2 Antibody (NBP1-90133)

Discover more about diseases related to cIAP-1/HIAP-2 Antibody (NBP1-90133).
 

Pathways for cIAP-1/HIAP-2 Antibody (NBP1-90133)

View related products by pathway.

PTMs for cIAP-1/HIAP-2 Antibody (NBP1-90133)

Learn more about PTMs related to cIAP-1/HIAP-2 Antibody (NBP1-90133).
 

Research Areas for cIAP-1/HIAP-2 Antibody (NBP1-90133)

Find related products by research area.

Blogs on cIAP-1/HIAP-2.

cIAP1 - An apoptotic regulator with implications in drug resistant cancers
Cellular inhibitor of apoptosis protein-1 (cIAP-1) is an anti-apoptotic protein that is able to bind to caspases and inhibit their activity. Additionally cIAP-1 contains a RING domain with E3 ubiquitin ligase activity that is able to mediate the r...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cIAP-1/HIAP-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BIRC2
Entrez