cIAP-1/HIAP-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: cIAP-1/HIAP-2 Antibody [NBP1-90133] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

cIAP-1/HIAP-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BIRC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  cIAP-1/HIAP-2 Protein (NBP1-90133PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for cIAP-1/HIAP-2 Antibody - BSA Free

• API1Hiap-2
• apoptosis inhibitor 1
• baculoviral IAP repeat containing 2
• baculoviral IAP repeat-containing 2
• baculoviral IAP repeat-containing protein 2
• BIRC2
• cIAP1
• C-IAP1
• cIAP-1
• hIAP2
• HIAP-2
• IAP homolog B
• IAP2
• IAP-2
• Inhibitor of apoptosis protein 2
• MIHB
• MIHBHIAP2
• NFR2-TRAF signalling complex protein
• RING finger protein 48
• RNF48hiap-2
• TNFR2-TRAF-signaling complex protein 2

Background

cIAP1 (HIAP2, MIHB) is a member of the family of inhibitor of apoptosis proteins (IAP). IAPs suppress mitochondria-dependent and -independent apoptosis by binding to and inhibiting caspases through their BIR domains (reviewed in Liston et al, 2003; Wright and Duckett, 2005). Resistance towards apoptosis is a hallmark of cancer cells, and overexpression of IAPs can contribute to the development of cancer though inhibiting apoptosis. In addition to at least one BIR domain, some IAP members also have a RING-type finger motif at their carboxyl-terminal. The RING finger domain of several IAPs, including cIAP2, have E3 ubiquitin ligase activity and target the degradation of Smac/DIABLO through ubqiuitination. Smac/DIABLO is a death inducer and functions by inhibiting IAP-caspase interactions, thereby promoting apoptosis. Degradation of cell death inducers like Smac/DIABLO is thought to be a conserved mechanism by which IAPs enhance their anti-apoptotic activity, thereby promoting cell survival. The IAPs, including cIAP1, have widespread tissue protein expression, with expression levels and subcellular localization patterns differing depending on the cell lineage (see Vischioni et al. 2005 for a comprehensive study). This antibody recognizes cIAP1, human cIAP1 is a 618 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for cIAP-1/HIAP-2 Antibody (NBP1-90133)(1)

Publication using NBP1-90133

• Werner TA, Nolten I, Dizdar L et al. IAPs cause resistance to TRAIL-dependent apoptosis in follicular thyroid cancer Endocr. Relat. Cancer 2018-01-09 [PMID: 29317481] (WB, Human)

Bioinformatics

• Gene Symbol: BIRC2