Chymotrypsin-like protease Antibody - BSA Free

Western Blot: Chymotrypsin-like protease Antibody [NBP1-87520] - Analysis in control (vector only transfected HEK293T lysate) and CTRL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP1-87520] - Staining of human lymph node.

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP1-87520] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP1-87520] - Staining in human pancreas and liver tissues using anti-CTRL antibody. Corresponding CTRL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP1-87520] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-CTRL antibody NBP1-87520 (A) shows similar protein distribution across tissues to independent antibody NBP2-33973 (B).

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP1-87520] - Staining of human pancreas shows high expression.

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody [NBP1-87520] - Staining of human cerebral cortex.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Chymotrypsin-like protease Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTRL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Chymotrypsin-like protease Protein (NBP1-87520PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Chymotrypsin-like protease Antibody - BSA Free

• chymotrypsin-like protease CTRL-1
• chymotrypsin-like
• CTRL1
• EC 3.4.21
• EC 3.4.21.-
• MGC70821

Background

CTRL - chymotrypsin-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTRL