CHX10 Antibody (4Z4R2)

Western Blot: CHX10 Antibody (4Z4R2) [NBP3-15945] - Western blot analysis of extracts of various cell lines, using CHX10 Rabbit mAb (NBP3-15945) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

• Reactivity: Mu, Rt
• Applications: WB
• Clone: 4Z4R2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CHX10 Antibody (4Z4R2) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 262-361 of human CHX10 (P58304). AAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: VSX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CHX10 Antibody (4Z4R2)

• ceh-10 homeo domain containing homolog (C. elegans)
• ceh-10 homeo domain containing homolog
• ceh-10 homeodomain containing homolog (C. elegans)
• Ceh-10 homeodomain-containing homolog
• CHX10MCOPCB3
• Homeobox protein CHX10
• HOX10C elegans ceh-10 homeo domain-containing homolog
• MCOP2
• RET1
• visual system homeobox 2

Background

The CHX10 gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in thisgene are associated with microphthalmia, cataracts and iris abnormalities. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VSX2