CEP110 Antibody

Images

 
Western Blot: CEP110 Antibody [NBP2-48546] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: CEP110 Antibody [NBP2-48546] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: CEP110 Antibody [NBP2-48546] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP110 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAILERNENLEGELESLKENLPFTMNEGPFEEKLNFSQVHIMDEHWRGEALREKLRHREDRLKAQLRHCMSKQAEVLIKGKRQTEGTLHSLRRQVDALGELVTST
Specificity
Specificity of human CEP110 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTRL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEP110 Recombinant Protein Antigen (NBP2-48546PEP)

Reactivity Notes

Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP110 Antibody

  • centriolin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2080
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-45889
Species: Hu
Applications: WB, IHC
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
H00011116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-56533
Species: Hu
Applications: ICC/IF
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
AF637
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CEP110 Antibody (NBP2-48546) (0)

There are no publications for CEP110 Antibody (NBP2-48546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP110 Antibody (NBP2-48546) (0)

There are no reviews for CEP110 Antibody (NBP2-48546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEP110 Antibody (NBP2-48546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CEP110 Antibody (NBP2-48546)

Discover related pathways, diseases and genes to CEP110 Antibody (NBP2-48546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP110 Antibody (NBP2-48546)

Discover more about diseases related to CEP110 Antibody (NBP2-48546).
 

Pathways for CEP110 Antibody (NBP2-48546)

View related products by pathway.

PTMs for CEP110 Antibody (NBP2-48546)

Learn more about PTMs related to CEP110 Antibody (NBP2-48546).

Blogs on CEP110

There are no specific blogs for CEP110, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP110 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTRL