Chordin-like 1/CHRDL1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DKKYRVGERWHPYLEPYGLVYCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPEDSLPPVNNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYC |
| Predicted Species |
Mouse (96%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CHRDL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Chordin-like 1/CHRDL1 Antibody - BSA Free
Background
CHRDL1 encodes an antagonist of bone morphogenetic protein 4. The encoded protein may play a role in topographic retinotectal projection and in the regulation of retinal angiogenesis in response to hypoxia. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: Block, IHC
Species: Mu
Applications: IHC, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IP, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for Chordin-like 1/CHRDL1 Antibody (NBP1-84485) (0)
There are no publications for Chordin-like 1/CHRDL1 Antibody (NBP1-84485).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Chordin-like 1/CHRDL1 Antibody (NBP1-84485) (0)
There are no reviews for Chordin-like 1/CHRDL1 Antibody (NBP1-84485).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Chordin-like 1/CHRDL1 Antibody (NBP1-84485). (Showing 1 - 1 of 1 FAQ).
-
Have you tested this antibody to detect "mouse" CHRDL1 Long-form and Short-form in Western blot?
- NBP1-84485 has an immunogen that shares 95% similarity to mouse, so it is predicted to cross-react with mouse. And it should also detect both isoforms in mouse. If you would be interested in testing this novel species, please take a look at our Innovator's Reward program.
Secondary Antibodies
| |
Isotype Controls
|
Additional Chordin-like 1/CHRDL1 Products
Blogs on Chordin-like 1/CHRDL1