Chordin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Chordin Antibody [NBP1-87513] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: Chordin Antibody [NBP1-87513] - Staining of human duodenum shows strong plasma positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chordin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRDLPGLPRSRDPGEGCYFDGDRSW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Chordin Protein (NBP1-87513PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Chordin Antibody

  • Chordin
  • CHRD
  • MGC133038
  • Sog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
AF1927
Species: Hu
Applications: WB, IP, ICC
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP1-91612
Species: Mu
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
AF2299
Species: Mu
Applications: WB, IHC
AF1075
Species: Hu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF756
Species: Mu
Applications: WB, IHC
NBP1-87508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for Chordin Antibody (NBP1-87513) (0)

There are no publications for Chordin Antibody (NBP1-87513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chordin Antibody (NBP1-87513) (0)

There are no reviews for Chordin Antibody (NBP1-87513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Chordin Antibody (NBP1-87513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chordin Products

Bioinformatics Tool for Chordin Antibody (NBP1-87513)

Discover related pathways, diseases and genes to Chordin Antibody (NBP1-87513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chordin Antibody (NBP1-87513)

Discover more about diseases related to Chordin Antibody (NBP1-87513).
 

Pathways for Chordin Antibody (NBP1-87513)

View related products by pathway.

PTMs for Chordin Antibody (NBP1-87513)

Learn more about PTMs related to Chordin Antibody (NBP1-87513).

Blogs on Chordin

There are no specific blogs for Chordin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chordin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRD
Entrez