Chondroadherin Antibody

Images

 
Western Blot: Chondroadherin Antibody [NBP1-87031] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Chondroadherin Antibody [NBP1-87031] - Staining of human bronchus shows strong positivity in cartilage.
Western Blot: Chondroadherin Antibody [NBP1-87031] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chondroadherin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Chondroadherin Protein (NBP1-87031PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Chondroadherin Antibody

  • CHAD
  • chondroadherin proteoglycan
  • Chondroadherin
  • SLRR4A
  • SLRR4ACartilage leucine-rich protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF5945
Species: Hu, Mu, Rt
Applications: WB
AF2667
Species: Hu
Applications: WB, IHC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6447
Species: Hu
Applications: WB, ICC, Neut
AF3308
Species: Mu
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-07799
Species: Hu

Publications for Chondroadherin Antibody (NBP1-87031) (0)

There are no publications for Chondroadherin Antibody (NBP1-87031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chondroadherin Antibody (NBP1-87031) (0)

There are no reviews for Chondroadherin Antibody (NBP1-87031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chondroadherin Antibody (NBP1-87031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chondroadherin Products

Bioinformatics Tool for Chondroadherin Antibody (NBP1-87031)

Discover related pathways, diseases and genes to Chondroadherin Antibody (NBP1-87031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chondroadherin Antibody (NBP1-87031)

Discover more about diseases related to Chondroadherin Antibody (NBP1-87031).
 

Pathways for Chondroadherin Antibody (NBP1-87031)

View related products by pathway.

PTMs for Chondroadherin Antibody (NBP1-87031)

Learn more about PTMs related to Chondroadherin Antibody (NBP1-87031).

Blogs on Chondroadherin

There are no specific blogs for Chondroadherin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chondroadherin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHAD
Entrez
Uniprot