CHMP6 Antibody

Images

 
Western Blot: CHMP6 Antibody [NBP1-83727] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: CHMP6 Antibody [NBP1-83727] - Staining of human testis shows distinct cytoplasmic positivity in cells of ductus seminiferus.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHMP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGNLFGCKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHMP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CHMP6 Protein (NBP1-83727PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHMP6 Antibody

  • charged multivesicular body protein 6
  • chromatin modifying protein 6
  • Chromatin-modifying protein 6
  • FLJ11749
  • Vacuolar protein sorting-associated protein 20
  • Vps20
  • VPS20hVps20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-89391
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2468
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-46283
Species: Hu
Applications: WB, IHC
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13519
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77198
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for CHMP6 Antibody (NBP1-83727) (0)

There are no publications for CHMP6 Antibody (NBP1-83727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHMP6 Antibody (NBP1-83727) (0)

There are no reviews for CHMP6 Antibody (NBP1-83727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHMP6 Antibody (NBP1-83727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHMP6 Products

Bioinformatics Tool for CHMP6 Antibody (NBP1-83727)

Discover related pathways, diseases and genes to CHMP6 Antibody (NBP1-83727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHMP6 Antibody (NBP1-83727)

Discover more about diseases related to CHMP6 Antibody (NBP1-83727).
 

Pathways for CHMP6 Antibody (NBP1-83727)

View related products by pathway.

PTMs for CHMP6 Antibody (NBP1-83727)

Learn more about PTMs related to CHMP6 Antibody (NBP1-83727).

Blogs on CHMP6

There are no specific blogs for CHMP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHMP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP6