CHFR Antibody - BSA Free

Western Blot: CHFR Antibody [NBP1-52955] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Immunohistochemistry-Paraffin: CHFR Antibody [NBP1-52955] - Human breast tissue at an antibody concentration of 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CHFR Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CHFR(checkpoint with forkhead and ring finger domains) The peptide sequence was selected from the N terminal of CHFR. Peptide sequence REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHFR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CHFR Antibody - BSA Free

• Checkpoint with forkhead and RING finger domains protein
• checkpoint with forkhead and ring finger domains
• E3 ubiquitin-protein ligase CHFR
• EC 6.3.2.-
• FLJ10796
• FLJ33629
• RING finger protein 196
• RNF196RNF116

Background

CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHFR
• Uniprot:
  • Q96EP1(Human)