CHFR Antibody


Western Blot: CHFR Antibody [NBP1-52955] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: CHFR Antibody [NBP1-52955] - Human breast tissue at an antibody concentration of 4-8ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CHFR Antibody Summary

Synthetic peptides corresponding to CHFR(checkpoint with forkhead and ring finger domains) The peptide sequence was selected from the N terminal of CHFR. Peptide sequence REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CHFR and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHFR Antibody

  • Checkpoint with forkhead and RING finger domains protein
  • checkpoint with forkhead and ring finger domains
  • E3 ubiquitin-protein ligase CHFR
  • EC 6.3.2.-
  • FLJ10796
  • FLJ33629
  • RING finger protein 196
  • RNF196RNF116


CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHFR Antibody (NBP1-52955) (0)

There are no publications for CHFR Antibody (NBP1-52955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHFR Antibody (NBP1-52955) (0)

There are no reviews for CHFR Antibody (NBP1-52955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHFR Antibody (NBP1-52955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CHFR Products

Bioinformatics Tool for CHFR Antibody (NBP1-52955)

Discover related pathways, diseases and genes to CHFR Antibody (NBP1-52955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHFR Antibody (NBP1-52955)

Discover more about diseases related to CHFR Antibody (NBP1-52955).

Pathways for CHFR Antibody (NBP1-52955)

View related products by pathway.

PTMs for CHFR Antibody (NBP1-52955)

Learn more about PTMs related to CHFR Antibody (NBP1-52955).

Research Areas for CHFR Antibody (NBP1-52955)

Find related products by research area.

Blogs on CHFR

There are no specific blogs for CHFR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CHFR Antibody and receive a gift card or discount.


Gene Symbol CHFR