ChemR23/CMKLR1 Antibody

Images

 
Immunohistochemistry-Paraffin: CMKLR1 Antibody [NBP2-13847] Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ChemR23/CMKLR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERET G
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CMKLR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ChemR23/CMKLR1 Protein (NBP2-13847PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ChemR23/CMKLR1 Antibody

  • CHEMERINR
  • chemokine receptor-like 1
  • chemokine-like receptor 1
  • ChemR23
  • cmklr1
  • Dez
  • Gpcr27
  • G-protein coupled receptor ChemR23
  • G-protein coupled receptor DEZ
  • MGC126105
  • MGC126106
  • orphan G-protein coupled receptor, Dez

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2325
Species: Mu
Applications: WB, Neut
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-27422
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP2-13847
Species: Hu
Applications: IHC, IHC-P

Publications for ChemR23/CMKLR1 Antibody (NBP2-13847) (0)

There are no publications for ChemR23/CMKLR1 Antibody (NBP2-13847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ChemR23/CMKLR1 Antibody (NBP2-13847) (0)

There are no reviews for ChemR23/CMKLR1 Antibody (NBP2-13847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ChemR23/CMKLR1 Antibody (NBP2-13847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ChemR23/CMKLR1 Products

Bioinformatics Tool for ChemR23/CMKLR1 Antibody (NBP2-13847)

Discover related pathways, diseases and genes to ChemR23/CMKLR1 Antibody (NBP2-13847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ChemR23/CMKLR1 Antibody (NBP2-13847)

Discover more about diseases related to ChemR23/CMKLR1 Antibody (NBP2-13847).
 

Pathways for ChemR23/CMKLR1 Antibody (NBP2-13847)

View related products by pathway.

PTMs for ChemR23/CMKLR1 Antibody (NBP2-13847)

Learn more about PTMs related to ChemR23/CMKLR1 Antibody (NBP2-13847).
 

Research Areas for ChemR23/CMKLR1 Antibody (NBP2-13847)

Find related products by research area.

Blogs on ChemR23/CMKLR1

There are no specific blogs for ChemR23/CMKLR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ChemR23/CMKLR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CMKLR1
Entrez