CHD2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CHD2 Antibody [NBP2-32577] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm & vesicles.
Immunohistochemistry: CHD2 Antibody [NBP2-32577] - Staining of human hippocampus shows moderate nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VTGGEEAKLKKRKPRVKKENKVPRLKEEHGIELSSPRHSDNPSEEGEVKDDGLEKSPMKKKQKKKENKENKEKQMSSRKDKEGDKERKKSKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHD2 Protein (NBP2-32577PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHD2 Antibody

  • ATP-dependent helicase CHD2
  • CHD-2
  • chromodomain helicase DNA binding protein 2
  • chromodomain-helicase-DNA-binding protein 2
  • DKFZp547I1315
  • DKFZp686E01200
  • DKFZp781D1727
  • EC 3.6.1
  • EC 3.6.4.12
  • FLJ38614

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60411
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-51593
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2458
Species: Mu
Applications: WB, IHC
NBP1-77393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16287
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-33873
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHD2 Antibody (NBP2-32577) (0)

There are no publications for CHD2 Antibody (NBP2-32577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD2 Antibody (NBP2-32577) (0)

There are no reviews for CHD2 Antibody (NBP2-32577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CHD2 Antibody (NBP2-32577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHD2 Products

Bioinformatics Tool for CHD2 Antibody (NBP2-32577)

Discover related pathways, diseases and genes to CHD2 Antibody (NBP2-32577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHD2 Antibody (NBP2-32577)

Discover more about diseases related to CHD2 Antibody (NBP2-32577).
 

Pathways for CHD2 Antibody (NBP2-32577)

View related products by pathway.

PTMs for CHD2 Antibody (NBP2-32577)

Learn more about PTMs related to CHD2 Antibody (NBP2-32577).
 

Research Areas for CHD2 Antibody (NBP2-32577)

Find related products by research area.

Blogs on CHD2

There are no specific blogs for CHD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHD2