CHD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CHD2 Antibody [NBP2-32563] - Immunofluorescent staining of human cell line SiHa shows localization to nucleus & vesicles.

Analysis in human testis and skeletal muscle tissues using NBP2-32563 antibody. Corresponding CHD2 RNA-seq data are presented for the same tissues.

Staining of human Testis shows strong nuclear positivity in spermatogonia.

Staining of human Endometrium shows strong nuclear positivity in glandular cells.

Staining of human Cerebral cortex shows strong nuclear positivity in neurons and glial cells.

Staining of human Skeletal muscle shows very weak nuclear positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QHWYKDHHYGDRRHMDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMS
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CHD2 Protein (NBP2-32563PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CHD2 Antibody - BSA Free

• ATP-dependent helicase CHD2
• CHD-2
• chromodomain helicase DNA binding protein 2
• chromodomain-helicase-DNA-binding protein 2
• DKFZp547I1315
• DKFZp686E01200
• DKFZp781D1727
• EC 3.6.1
• EC 3.6.4.12
• FLJ38614

Background

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHD2 Antibody (NBP2-32563)(1)

Publication using NBP2-32563

• Lasser M, Sun N, Xu Y et al. Pleiotropy of autism-associated chromatin regulators Development 2023-07-15 [PMID: 37366052] (Western Blot)

Bioinformatics

• Gene Symbol: CHD2