CHCHD4 Antibody - BSA Free

Western Blot: CHCHD4 Antibody [NBP1-54783] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CHCHD4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CHCHD4(coiled-coil-helix-coiled-coil-helix domain containing 4) The peptide sequence was selected from the N terminal of CHCHD4. Peptide sequence MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHCHD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CHCHD4 Antibody - BSA Free

• CHDH4
• coiled-coil-helix-coiled-coil-helix domain containing 4
• Coiled-coil-helix-coiled-coil-helix domain-containing protein 4
• FLJ31709
• MIA40mitochondrial intermembrane space import and assembly protein 40
• mitochondrial intermembrane space import and assembly 40 homolog
• TIMM40
• translocase of inner mitochondrial membrane 40 homolog

Background

CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHCHD4
• Uniprot:
  • Q8N4Q1(Human)