Recombinant Human CHAF1A GST (N-Term) Protein

SDS-Page: Recombinant Human CHAF1A Protein [H00010036-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human CHAF1A GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 21-120 of Human CHAF1A partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CHAF1A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHAF1A GST (N-Term) Protein

• CAF
• CAF-1 subunit A
• CAF1
• CAF-1
• CAF1B
• CAF1P150CAF-I 150 kDa subunit
• CAF-I p150
• chromatin assembly factor 1 subunit A
• chromatin assembly factor 1, subunit A (p150)
• chromatin assembly factor I (150 kDa)
• Chromatin assembly factor I p150 subunit
• hp150
• MGC71229
• P150

Background

CHAF1A - chromatin assembly factor 1, subunit A (p150)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CHAF1A Partial Recombinant Protein (H00010036-Q01)(2)

Publications using H00010036-Q01

• Nozawa K, Doe K, Uomori K et al. Antiribonuclease H2 antibodies are an immune biomarker for systemic lupus erythematosus. Autoimmunity 2017-05-27 [PMID: 28553742]
• Doe K, Nozawa K, Hiruma K et al. Antibody against chromatin assembly factor-1 is a novel autoantibody specifically recognized in systemic lupus erythematosus. Lupus. 2014-05-01 [PMID: 24836587]

Bioinformatics

• Gene Symbol: CHAF1A