cGK2/PRKG2 Antibody - BSA Free

Western Blot: cGK2/PRKG2 Antibody [NBP3-35308] - Western blot analysis of various lysates using cGK2/PRKG2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunoprecipitation: cGK2/PRKG2 Antibody [NBP3-35308] - Immunoprecipitation analysis of 600 ug extracts of Mouse lung using 3 ug cGK2/PRKG2 antibody. Western blot was performed from the immunoprecipitate using cGK2/PRKG2 antibody at a dilution of 1:1000.

• Reactivity: Mu, Rt
• Applications: WB, ELISA, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

cGK2/PRKG2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit cGK2/PRKG2 Antibody - BSA Free (NBP3-35308) is a polyclonal antibody validated for use in WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human cGK2/PRKG2 (NP_006250.1).
  
  Sequence:
  MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLIT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 87 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for cGK2/PRKG2 Antibody - BSA Free

• cGK 2
• cGK2
• cGK2/PRKG2
• cGKII
• cGKIIcGK2
• cGMP-dependent protein kinase 2
• cGMP-dependent protein kinase II
• EC 2.7.11
• PRKG2
• PRKGR2
• PRKGR2EC 2.7.11.12
• protein kinase, cGMP-dependent, type II

Background

cGK2/PRKG2, also known as cGMP-dependent protein kinase 2, is 762 amino acids long and approximately 87kDa. cGK2/PRKG2 is a protein kinase that is highly expressed in the brain, intestine and lung. Current research surrounding cGK2/PRKG2 has shown a potential link with several disorders and diseases including cystic fibrosis, gout, malaria, lung cancer, alcoholism, diarrhea, and hyperphenylalaninemia. cGK2/PRKG2 may also interact with PTS, LASP1, YWHAB, MYLK, and PLCB3 in pathways such as cGMP signaling, platelet homeostasis, EDNRB signaling, signaling in gap junctions, nitric oxide metabolism, and eNOS activation and regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKG2