Guanylin Antibody

Images

 
Western Blot: Guanylin Antibody [NBP1-89724] - Analysis in control (vector only transfected HEK293T lysate) and gUCA2A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Guanylin Antibody [NBP1-89724] - Staining of human small intestine shows strong cytoplasmic positivity in paneth cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Guanylin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCA2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Guanylin Protein (NBP1-89724PEP)
Publications
Read Publications using
NBP1-89724 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25304930).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Guanylin Antibody

  • GCAP-I
  • guanylate cyclase activator 2A (guanylin)
  • Guanylate cyclase activator 2A
  • Guanylate cyclase-activating protein 1
  • Guanylate cyclase-activating protein I
  • guanylin
  • GUCA2guanylate cyclase activator 2A (guanylin 2, intestinal, heat-stable)
  • STARA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81788
Species: Hu
Applications: IHC, IHC-P
H00002981-T01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002978-R01V
Species: Hu
NBP1-84497
Species: Hu
Applications: IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-89724
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Guanylin Antibody (NBP1-89724)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Guanylin Antibody (NBP1-89724) (0)

There are no reviews for Guanylin Antibody (NBP1-89724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Guanylin Antibody (NBP1-89724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Guanylin Products

Bioinformatics Tool for Guanylin Antibody (NBP1-89724)

Discover related pathways, diseases and genes to Guanylin Antibody (NBP1-89724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Guanylin Antibody (NBP1-89724)

Discover more about diseases related to Guanylin Antibody (NBP1-89724).
 

Pathways for Guanylin Antibody (NBP1-89724)

View related products by pathway.

Blogs on Guanylin

There are no specific blogs for Guanylin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Guanylin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCA2A