Ceruloplasmin Antibody

Images

 
Western Blot: Ceruloplasmin Antibody [NBP2-82663] - Host: Rabbit. Target Name: CP. Sample Tissue: Human Liver Tumor. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ceruloplasmin Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Ceruloplasmin. Peptide sequence: HIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ceruloplasmin Antibody

  • ceruloplasmin (ferroxidase)
  • ceruloplasmin
  • CP-2
  • EC 1.16.3.1
  • Ferroxidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2914-HT
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6967
Species: Hu
Applications: WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DCRP00
Species: Hu
Applications: ELISA
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
D6050
Species: Hu
Applications: ELISA
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
396-HB/CF
Species: Hu
Applications: BA
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Ceruloplasmin Antibody (NBP2-82663) (0)

There are no publications for Ceruloplasmin Antibody (NBP2-82663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ceruloplasmin Antibody (NBP2-82663) (0)

There are no reviews for Ceruloplasmin Antibody (NBP2-82663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ceruloplasmin Antibody (NBP2-82663). (Showing 1 - 1 of 1 FAQ).

  1. We want to set up a Ceruloplasmin enzyme immunoassay. Could you suggest a suitable/optimal antibody pair for a sandwich format?
    • Currently we do not carry any validated antibody pairs for sandwich ELISA to detect ceruloplasmin, however we do have ELISA kits that have been optimized and validated for human and rat.

Secondary Antibodies

 

Isotype Controls

Additional Ceruloplasmin Products

Bioinformatics Tool for Ceruloplasmin Antibody (NBP2-82663)

Discover related pathways, diseases and genes to Ceruloplasmin Antibody (NBP2-82663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ceruloplasmin Antibody (NBP2-82663)

Discover more about diseases related to Ceruloplasmin Antibody (NBP2-82663).
 

Pathways for Ceruloplasmin Antibody (NBP2-82663)

View related products by pathway.

PTMs for Ceruloplasmin Antibody (NBP2-82663)

Learn more about PTMs related to Ceruloplasmin Antibody (NBP2-82663).
 

Research Areas for Ceruloplasmin Antibody (NBP2-82663)

Find related products by research area.

Blogs on Ceruloplasmin

There are no specific blogs for Ceruloplasmin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ceruloplasmin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CP