CEP72 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CEP72 Antibody [NBP2-57811] - Staining of human cell line U-2 OS shows localization to centrosome.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CEP72 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNEHLLQELSQVRAQHRAEVEQMHWSYQELKKTMALF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEP72
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CEP72 Recombinant Protein Antigen (NBP2-57811PEP)

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CEP72 Antibody - BSA Free

• centrosomal protein 72kDa
• centrosomal protein of 72 kDa
• Cep72
• KIAA1519FLJ10565
• MGC5307

Background

CEP72 is a centrosomal protein that belongs to the leucine-rich-repeat (LRR) superfamily of proteins. The specific function of CEP72 has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEP72