Home » BBS4 » BBS4 Antibodies » BBS4 Antibody

BBS4 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: BBS4 Antibody [NBP1-86248] - Analysis in control (vector only transfected HEK293T lysate) and BBS4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: BBS4 Antibody [NBP1-86248] - Analysis in control (vector only transfected HEK293T lysate) and BBS4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: BBS4 Antibody [NBP1-86248] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: BBS4 Antibody [NBP1-86248] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BBS4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL
Specificity
Specificity of human BBS4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BBS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BBS4 Antibody

  • Bardet-Biedl syndrome 4 protein
  • Bardet-Biedl syndrome 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBS2 Antibody
NBP1-69082
Western Blot: BBS2 Antibody [NBP1-69082] - Titration: 1.0 ug/ml Positive Control: MCF7 Whole Cell.
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
MKKS Antibody
NBP1-92123
Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human urinary bladder.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BBS1 Antibody
NBP1-79684
Western Blot: BBS1 Antibody [NBP1-79684] - Titration: 0.2-1 ug/ml, Positive Control: Mouse liver.
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP
Applications: WB
PCM1 Antibody
NBP1-87196
Immunocytochemistry/Immunofluorescence: PCM1 Antibody [NBP1-87196] - Staining of human cell line U-251 MG shows localization to nuclear membrane & centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87196] - Staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: PCM1 Antibody [NBP1-87196] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
BBS7 Antibody
NBP1-88690
Western Blot: BBS7 Antibody [NBP1-88690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: BBS7 Antibody [NBP1-88690] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ARL6 Antibody
NBP1-88689
Western Blot: ARL6 Antibody [NBP1-88689] - Analysis in control (vector only transfected HEK293T lysate) and ARL6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ARL6 Antibody [NBP1-88689] - Staining of human kidney shows strong cytoplasmic positivity in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
TTC8 Antibody
NBP1-55108
Western Blot: TTC8 Antibody [NBP1-55108] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
BBS5 Antibody
NBP1-55191
Western Blot: BBS5 Antibody [NBP1-55191] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
Species: Hu, Mu, Rt, Bv, Eq, GP, Ze
Applications: WB
MBD1 Antibody
(100B272.1)
NB100-56537
Western Blot: MBD1 Antibody (100B272.1) [NB100-56537] - Analysis using Azide and BSA Free version of NB100-56537. Jurkat cell lysate using anti-MBD1 antibody. Image from verified customer review.
Western Blot: MBD1 Antibody (100B272.1) [NB100-56537] - Analysis of Jurkat cell lysate using anti-MBD1 antibody. Image from verified customer review.
Western Blot: MBD1 Antibody (100B272.1) [NB100-56537] - Analysis of MBD1 in HeLa lysate using MBD1 antibody at 2 ug/ml (lane 1) and 1 ug/ml (lane 2).
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr, IP
Rhodopsin Antibody
(B630)
NBP2-25160
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important to avoid boiling samples containing this protein in SDS-PAGE sample buffer, as this will result in even more extensive aggregation of the Rhodopsin protein and appearance of more of this high molecular weight material.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
DISC1 Antibody
NB110-40775
Immunocytochemistry/Immunofluorescence: DISC1 Antibody [NB110-40775] - DISC1 antibody was tested in PC-12 cells at 1:100 with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 549 (red).
Immunohistochemistry: DISC1 Antibody [NB110-40775] - Staining of DISC1 in mouse brain neurons, glial cells, and white matter. 40X
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
CEP290 Antibody
NB100-86991
Western Blot: CEP290 Antibody [NB100-86991] - Detection of human CEP290 by western blot and immunoprecipitation. Samples: Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) and HEK293T (T; 50 ug) cells. Antibodies: Affinity purified rabbit anti-CEP290 antibody NB100-86991 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 10 second (B).
Immunocytochemistry/Immunofluorescence: CEP290 Antibody [NB100-86991] - NBF-fixed asynchronous HeLa cells. Antibody used at a dilution of 1:500.
Western Blot: CEP290 Antibody [NB100-86991] - Species: Mouse, Cell line: Brain homogenate, Primary antibody dilution: 1:400. Band detected at 300KDa. This image has been provided by Manfred W. Kilimann, MD, PhD, Professor in Molecular Cell Biology, Uppsala University.
(9 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IP
BBS10 Antibody
NBP1-32740
Western Blot: BBS10 Antibody [NBP1-32740] - (30 ug of whole cell lysate) A: Hep G2 7.5% SDS PAGE diluted at 1:1000
Immunohistochemistry-Paraffin: BBS10 Antibody [NBP1-32740] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
RAB8A Antibody
(3G1)
H00004218-M02
Western Blot: RAB8A Antibody (3G1) [H00004218-M02] - RAB8A monoclonal antibody (M02), clone 3G1 Analysis of RAB8A expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: RAB8A Antibody (3G1) [H00004218-M02] - Neuromast hair cells of zebrafish embryos stained with RAB8A antibody. Donkey anti-mouse Alexa Fluor 594 secondary antibody was used. Image from verified customer.
Immunohistochemistry-Paraffin: RAB8A Antibody (3G1) [H00004218-M02] - Immunoperoxidase of monoclonal antibody to RAB8A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]
(1 Review)
(6 Publications)
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Ninein Antibody
NBP2-13657
Immunocytochemistry/Immunofluorescence: Ninein Antibody [NBP2-13657] - Staining of human cell line U-251 MG shows localization to nucleoli and centrosome.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining in human appendix and pancreas tissues using anti-NIN antibody. Corresponding NIN RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human appendix shows distinct dot-like positivity in lymphoid cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(9 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
BBS12 Antibody
H00166379-B01P
Western Blot: BBS12 Antibody [H00166379-B01P] - Analysis of BBS12 expression in NIH/3T3.
Western Blot: BBS12 Antibody [H00166379-B01P] - Analysis of FLJ35630 expression in Y-79.
Western Blot: BBS12 Antibody [H00166379-B01P] - Analysis of BBS12 expression in transfected 293T cell line by BBS12 polyclonal antibody. Lane 1: FLJ35630 transfected lysate(78.1 KDa). Lane 2: Non-transfected lysate.
Species: Hu, Mu
Applications: WB, ELISA
TRAF3IP1 Antibody
NBP2-14847
Immunohistochemistry-Paraffin: TRAF3IP1 Antibody [NBP2-14847] - analysis of TRAF3IP1. Human testis probed with TRAF3IP1 antibody at 5 ug/ml.
Species: Hu, Pm
Applications: IHC, IHC-P
MKS1 Antibody
NBP1-88691
Western Blot: MKS1 Antibody [NBP1-88691] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: MKS1 Antibody [NBP1-88691] - Staining of human kidney.
Immunohistochemistry-Paraffin: MKS1 Antibody [NBP1-88691] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
BBS4 Antibody
NBP1-86248
BBS4 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BBS4 Antibody (NBP1-86248) (0)

There are no publications for BBS4 Antibody (NBP1-86248).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBS4 Antibody (NBP1-86248) (0)

There are no reviews for BBS4 Antibody (NBP1-86248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BBS4 Antibody (NBP1-86248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional BBS4 Products

Bioinformatics Tool for BBS4 Antibody (NBP1-86248)

Discover related pathways, diseases and genes to BBS4 Antibody (NBP1-86248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS4 Antibody (NBP1-86248)

Discover more about diseases related to BBS4 Antibody (NBP1-86248).
 

Pathways for BBS4 Antibody (NBP1-86248)

View related products by pathway.

Research Areas for BBS4 Antibody (NBP1-86248)

Find related products by research area.

Blogs on BBS4

There are no specific blogs for BBS4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BBS4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BBS4