BBS4 Antibody


Western Blot: BBS4 Antibody [NBP1-86248] - Analysis in control (vector only transfected HEK293T lysate) and BBS4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: BBS4 Antibody [NBP1-86248] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: BBS4 Antibody [NBP1-86248] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

BBS4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESL
Specificity of human BBS4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BBS4 Antibody

  • Bardet-Biedl syndrome 4 protein
  • Bardet-Biedl syndrome 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
Species: Hu, Mu, Rt, Bv, Eq, GP, Ze
Applications: WB
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BBS4 Antibody (NBP1-86248) (0)

There are no publications for BBS4 Antibody (NBP1-86248).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBS4 Antibody (NBP1-86248) (0)

There are no reviews for BBS4 Antibody (NBP1-86248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BBS4 Antibody (NBP1-86248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional BBS4 Products

Bioinformatics Tool for BBS4 Antibody (NBP1-86248)

Discover related pathways, diseases and genes to BBS4 Antibody (NBP1-86248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS4 Antibody (NBP1-86248)

Discover more about diseases related to BBS4 Antibody (NBP1-86248).

Pathways for BBS4 Antibody (NBP1-86248)

View related products by pathway.

Research Areas for BBS4 Antibody (NBP1-86248)

Find related products by research area.

Blogs on BBS4

There are no specific blogs for BBS4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BBS4 Antibody and receive a gift card or discount.


Gene Symbol BBS4