CEP70 Antibody

Images

 
Western Blot: CEP70 Antibody [NBP2-84658] - Host: Rabbit. Target Name: CEP70. Sample Type: Placenta lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP70 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP70. Peptide sequence: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CEP70
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP70 Antibody

  • BITEFLJ13036
  • centrosomal protein 70kDa
  • centrosomal protein of 70 kDa
  • Cep70
  • p10-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-92503
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DSHBG0B
Species: Hu
Applications: ELISA
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2605
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DBD00
Species: Hu
Applications: ELISA
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-88795
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-91988
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
NBP2-13881
Species: Hu
Applications: IHC, IHC-P

Publications for CEP70 Antibody (NBP2-84658) (0)

There are no publications for CEP70 Antibody (NBP2-84658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP70 Antibody (NBP2-84658) (0)

There are no reviews for CEP70 Antibody (NBP2-84658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEP70 Antibody (NBP2-84658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEP70 Products

Array NBP2-84658

Bioinformatics Tool for CEP70 Antibody (NBP2-84658)

Discover related pathways, diseases and genes to CEP70 Antibody (NBP2-84658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP70 Antibody (NBP2-84658)

Discover more about diseases related to CEP70 Antibody (NBP2-84658).
 

Pathways for CEP70 Antibody (NBP2-84658)

View related products by pathway.

Blogs on CEP70

There are no specific blogs for CEP70, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP70 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP70