CEBP epsilon Antibody - Azide and BSA Free

Western Blot: CEBP epsilon Antibody [H00001053-D01P] - Analysis of CEBPE expression in mouse liver.

Western Blot: CEBP epsilon Antibody [H00001053-D01P] - Analysis of CEBPE expression in transfected 293T cell line by CEBPE rabbit polyclonal antibody.Lane 1: CEBPE transfected lysate(30.60 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CEBP epsilon Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CEBPE (NP_001796.2, 1 a.a. - 281 a.a.) full-length human protein. MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
• Specificity: CEBPE - CCAAT/enhancer binding protein (C/EBP), epsilon,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEBPE
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CEBP epsilon Antibody - Azide and BSA Free

• C/EBP-epsilon
• CCAAT/enhancer binding protein (C/EBP), epsilon
• CCAAT/enhancer-binding protein epsilon
• CEBP epsilon
• CEBPE
• CRP1C/EBP epsilon

Background

The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEBPE
• Entrez:
  • 1053(Human)
• Uniprot:
  • NP_001796.2(Human)