Cdx1 Antibody (8F6T7) Summary
| Description |
Novus Biologicals Rabbit Cdx1 Antibody (8F6T7) (NBP3-16822) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cdx1 (P47902). MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSP |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CDX1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cdx1 Antibody (8F6T7)
Background
The transcription factors Cdx1 and Cdx2 are members of the caudal-related homeobox gene family based on their homology to the factor caudal in Drosophila melanogaster. The caudal homeobox factor is required for anterior-posterior regional identity and axial patterning in Drosophila. During mouse development, the expression of Cdx1 and Cdx2 can be divided into two stages that likely reflect distinct roles. During early development, these two factors are expressed in a Hox-like manner in the three germ layers and appear to have overlapping functions in anterior-posterior patterning and posterior axis elongation. The second stage of Cdx1 and Cdx2 expression, from late development into adulthood, is characterized by the loss of expression almost everywhere but the epithelium of small intestine and colon. Putative intestine-specific enhancers upstream of the CDX1 gene have been identified that may orchestrate the switch in expression patterns for that gene. As might be expected from this pattern of expression, a wide variety of in vivo and in vitro studies have suggested that these two factors are important in controlling epithelial cell differentiation, proliferation, and function in the intestine.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Publications for Cdx1 Antibody (NBP3-16822) (0)
There are no publications for Cdx1 Antibody (NBP3-16822).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cdx1 Antibody (NBP3-16822) (0)
There are no reviews for Cdx1 Antibody (NBP3-16822).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cdx1 Antibody (NBP3-16822) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cdx1 Products
Research Areas for Cdx1 Antibody (NBP3-16822)
Find related products by research area.
|
Blogs on Cdx1