CDP/CUTL1 Antibody - BSA Free

Western Blot: CDP/CUTL1 Antibody [NBP3-10866] - Western blot analysis of CDP/CUTL1 in Mouse Small Intestine lysates. Antibody dilution at 1ug/ml

Product Discontinued

CDP/CUTL1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse CDP/CUTL1 (NP_001278162.1). Peptide sequence PEEKEALKRAYQQKPYPSPKTIEELATQLNLKTSTVINWFHNYRSRIRRE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CUX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CDP/CUTL1 Antibody - BSA Free

• CASP
• CCAAT displacement protein
• CDP
• CDP/Cux
• CDPCCAAT displacement protein
• COY1
• cut (Drosophila)-like 1 (CCAAT displacement protein)
• CUT
• CUTL1
• cut-like 1, CCAAT displacement protein (Drosophila)
• cut-like homeobox 1
• CUX
• CUX1
• FLJ31745
• golgi integral membrane protein 6
• GOLIM6
• homeobox protein cut-like 1
• Homeobox protein cux-1
• Nbla10317
• p100
• p110
• p200
• p75
• protein CASP
• putative protein product of Nbla10317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CUX1