Home » CDP/CUTL1 » CDP/CUTL1 Antibodies » CDP/CUTL1 Antibody

CDP/CUTL1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CDP/CUTL1 Antibody [NBP3-10866] - Western blot analysis of CDP/CUTL1 in Mouse Small Intestine lysates. Antibody dilution at 1ug/ml
Western Blot: CDP/CUTL1 Antibody [NBP3-10866] - Western blot analysis of CDP/CUTL1 in Mouse Small Intestine lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CDP/CUTL1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CDP/CUTL1 (NP_001278162.1). Peptide sequence PEEKEALKRAYQQKPYPSPKTIEELATQLNLKTSTVINWFHNYRSRIRRE
Clonality
Polyclonal
Host
Rabbit
Gene
CUX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for CDP/CUTL1 Antibody

  • CASP
  • CCAAT displacement protein
  • CDP
  • CDP/Cux
  • CDPCCAAT displacement protein
  • COY1
  • cut (Drosophila)-like 1 (CCAAT displacement protein)
  • CUT
  • CUTL1
  • cut-like 1, CCAAT displacement protein (Drosophila)
  • cut-like homeobox 1
  • CUX
  • CUX1
  • FLJ31745
  • golgi integral membrane protein 6
  • GOLIM6
  • homeobox protein cut-like 1
  • Homeobox protein cux-1
  • Nbla10317
  • p100
  • p110
  • p200
  • p75
  • protein CASP
  • putative protein product of Nbla10317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(719 Publications)
Species: Hu
Applications: BA

NGFR/TNFRSF16/p75NTR A ...
MAB367
NGF R/TNFRSF16 was detected in immersion fixed canine mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed human mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using 25 µg/mL Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(6 Publications)
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
BDNF [HRP]
DBD00
(4 Reviews)
(79 Publications)
Species: Hu
Applications: ELISA
TNF RI/TNFRSF1A
[HRP]
DRT100
(2 Reviews)
(79 Publications)
Species: Hu
Applications: ELISA
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
CD25/IL-2R alpha
[HRP]
DR2A00
(33 Publications)
Species: Hu
Applications: ELISA
TrkA Antibody
[Unconjugated]
AF1056
TrkA was detected in perfusion fixed frozen sections of rat dorsal root ganglion using 15 µg/mL Rat TrkA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1056) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysate of rat striatum tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Rat TrkA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1056) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for TrkA at approximately 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
(23 Publications)
Species: Rt
Applications: IHC, WB
ERG Antibody - BSA
Free
NBP2-60655
Immunocytochemistry/Immunofluorescence: ERG Antibody [NBP2-60655] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-ERG at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: ERG Antibody [NBP2-60655] - Total protein from Human THP-1, Jurkat and K562 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-ERG in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: ERG Antibody [NBP2-60655] - IHC analysis of a formalin fixed paraffin embedded tissue section of the human kidney (NBP1-78269) using 1:100 dilution of ERG antibody. The signal was developed using HRP-DAB method which followed counterstaining of the cells with hematoxylin. The antibody generated mainly a nuclear staining with weak cytoplasmic positivity in the cells of the glomeruli and the tubular epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Protein Disulfide
Isomerase/P4HB Antibo ...
NB300-517
Western Blot: Protein Disulfide Isomerase/P4HB Antibody (RL90) [NB300-517] - Cell surface Protein Disulfide Isomerase/P4HB associated with GC-AC. Proteins were pulled down with anti GC-A antibody from HUVEC or HMC membrane preparations and detected with anti-Protein Disulfide Isomerase/P4HB antibody (RL90)compared to control IP (no anti GC-A) and non-immunoprecipitated proteins from HMC and HUVEC. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112986), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody (RL90) [NB300-517] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in PBS for 10 minutes at room temperature and blocked with 2% BSA in PBS + 0.1% Triton X-100 for 30 minutes at room temperature. Cells were probed with a Protein Disulfide Isomerase/P4HB monoclonal antibody at a dilution of 1:75 for at least 1 hour at room temperature, washed with PBS, and incubated with Dylight 488 goat anti-mouse IgG secondary antibody at a dilution of 1:250 for 30 minutes at room temperature. Actin was stained with Dylight 350 Phalloidin at a dilution of 1:120 (2.5units/ml final concentration) and nuclei (red) were stained with DRAQ5 at a concentration of 1ug/ml for 30 minutes.
Immunocytochemistry/Immunofluorescence: Protein Disulfide Isomerase/P4HB Antibody (RL90) [NB300-517] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in PBS for 10 minutes at room temperature and blocked with 2% BSA in PBS + 0.1% Triton X-100 for 30 minutes at room temperature. Cells were probed with a Protein Disulfide Isomerase/P4HB monoclonal antibody at a dilution of 1:75 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 550 goat anti-mouse IgG secondary antibody at a dilution of 1:250 for 30 minutes at room temperature. Actin was stained with DyLight 488 Phalloidin at a dilution of 1:300 (1 unit/ml final concentration) for 30 minutes.
(3 Reviews)
(22 Publications)
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
PI 3-Kinase p55
gamma Antibody (SR44- ...
NBP2-67329
Immunocytochemistry/Immunofluorescence: PI 3-Kinase p55 gamma Antibody (SR44-06) [NBP2-67329] - Staining PI 3 Kinase p55 ? in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PI 3-Kinase p55 gamma Antibody (SR44-06) [NBP2-67329] - Analysis of paraffin-embedded mouse brain tissue using anti-PI 3 Kinase p55 ? antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: PI 3-Kinase p55 gamma Antibody (SR44-06) [NBP2-67329] - Analysis of paraffin-embedded mouse testis tissue using anti-PI 3 Kinase p55 ? antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Fascin Antibody
(833223) [Unconjugate
MAB7745
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line, loaded at 0.5 mg/mL. A specific band was detected for Fascin at approximately 61 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human Fascin Monoclonal Antibody (Catalog # MAB7745). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Fascin knockout HeLa cell line (KO). PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Fascin Monoclonal Antibody (Catalog # MAB7745) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Fascin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # MAB5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1. New adjunct appears with knockout cell line.
Fascin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Fascin Monoclonal Antibody (Catalog # MAB7745) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to synusoids. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: IHC, KO, Simple Western, WB
MPP1 Antibody
(1E11-1G11)
H00004354-M01
Western Blot: MPP1 Antibody (1E11-1G11) [H00004354-M01] - Analysis of MPP1 expression in transfected 293T cell line by MPP1 monoclonal antibody (M01), clone 1E11-1G11.Lane 1: MPP1 transfected lysate (Predicted MW: 52.3 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: MPP1 Antibody (1E11-1G11) [H00004354-M01] - Analysis of monoclonal antibody to MPP1 on HeLa cell . Antibody concentration 10 ug/ml.
Immunoprecipitation: MPP1 Antibody (1E11-1G11) [H00004354-M01] - Analysis of MPP1 transfected lysate using anti-MPP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MPP1 monoclonal antibody.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
PSMD12 Antibody
NBP1-87801
Immunocytochemistry/Immunofluorescence: PSMD12 Antibody [NBP1-87801] - Immunofluorescent staining of human cell line U-251 MG shows localization to microtubules.
Immunohistochemistry-Paraffin: PSMD12 Antibody [NBP1-87801] - Staining of human salivary gland shows low expression as expected.
Immunohistochemistry-Paraffin: PSMD12 Antibody [NBP1-87801] - Staining in human testis and salivary gland tissues using anti-PSMD12 antibody. Corresponding PSMD12 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
POLG2 Antibody
NBP2-94064
Immunocytochemistry/Immunofluorescence: POLG2 Antibody [NBP2-94064] - Analysis of MCF7 cells using POLG2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: POLG2 Antibody [NBP2-94064] - Human stomach using POLG2 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: POLG2 Antibody [NBP2-94064] - Mouse kidney using POLG2 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(342 Publications)
Species: Hu
Applications: BA
beta-NGF
[Unconjugated]
256-GF/CF
1 µg/lane of Recombinant Human beta -NGF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human beta -NGF (Catalog # 256‑GF/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.2-2 ng/mL.
(46 Publications)
Species: Hu
Applications: BA
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Species: Hu
Applications: IHC, IHC-P, KD, WB
LEDGF Antibody
(762815)
MAB3468
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. Gels were loaded with 40 µg of cytoplasmic (Cyto) and 20 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for LEDGF p75 at approximately 75 kDa and LEDGF p52 at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
LEDGF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC, WB
CDP/CUTL1 Antibody
NBP3-10866
CDP/CUTL1 Antibody
Species: Mu
Applications: WB

Publications for CDP/CUTL1 Antibody (NBP3-10866) (0)

There are no publications for CDP/CUTL1 Antibody (NBP3-10866).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDP/CUTL1 Antibody (NBP3-10866) (0)

There are no reviews for CDP/CUTL1 Antibody (NBP3-10866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDP/CUTL1 Antibody (NBP3-10866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDP/CUTL1 Products

Bioinformatics Tool for CDP/CUTL1 Antibody (NBP3-10866)

Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (NBP3-10866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDP/CUTL1 Antibody (NBP3-10866)

Discover more about diseases related to CDP/CUTL1 Antibody (NBP3-10866).
 

Pathways for CDP/CUTL1 Antibody (NBP3-10866)

View related products by pathway.

PTMs for CDP/CUTL1 Antibody (NBP3-10866)

Learn more about PTMs related to CDP/CUTL1 Antibody (NBP3-10866).

Blogs on CDP/CUTL1

There are no specific blogs for CDP/CUTL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDP/CUTL1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CUX1