CDP/CUTL1 Antibody

Images

 
Western Blot: CDP/CUTL1 Antibody [NBP3-10866] - Western blot analysis of CDP/CUTL1 in Mouse Small Intestine lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDP/CUTL1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CDP/CUTL1 (NP_001278162.1). Peptide sequence PEEKEALKRAYQQKPYPSPKTIEELATQLNLKTSTVINWFHNYRSRIRRE
Clonality
Polyclonal
Host
Rabbit
Gene
CUX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for CDP/CUTL1 Antibody

  • CASP
  • CCAAT displacement protein
  • CDP
  • CDP/Cux
  • CDPCCAAT displacement protein
  • COY1
  • cut (Drosophila)-like 1 (CCAAT displacement protein)
  • CUT
  • CUTL1
  • cut-like 1, CCAAT displacement protein (Drosophila)
  • cut-like homeobox 1
  • CUX
  • CUX1
  • FLJ31745
  • golgi integral membrane protein 6
  • GOLIM6
  • homeobox protein cut-like 1
  • Homeobox protein cux-1
  • Nbla10317
  • p100
  • p110
  • p200
  • p75
  • protein CASP
  • putative protein product of Nbla10317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
DBD00
Species: Hu
Applications: ELISA
DRT100
Species: Hu
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
DR2A00
Species: Hu
Applications: ELISA
AF1056
Species: Rt
Applications: IHC, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP2-67329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB7745
Species: Hu
Applications: IHC, KO, Simple Western, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-87801
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
202-IL
Species: Hu
Applications: BA
256-GF/CF
Species: Hu
Applications: BA
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
MAB3468
Species: Hu
Applications: ICC, WB
NBP3-10866
Species: Mu
Applications: WB

Publications for CDP/CUTL1 Antibody (NBP3-10866) (0)

There are no publications for CDP/CUTL1 Antibody (NBP3-10866).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDP/CUTL1 Antibody (NBP3-10866) (0)

There are no reviews for CDP/CUTL1 Antibody (NBP3-10866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDP/CUTL1 Antibody (NBP3-10866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDP/CUTL1 Products

Bioinformatics Tool for CDP/CUTL1 Antibody (NBP3-10866)

Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (NBP3-10866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDP/CUTL1 Antibody (NBP3-10866)

Discover more about diseases related to CDP/CUTL1 Antibody (NBP3-10866).
 

Pathways for CDP/CUTL1 Antibody (NBP3-10866)

View related products by pathway.

PTMs for CDP/CUTL1 Antibody (NBP3-10866)

Learn more about PTMs related to CDP/CUTL1 Antibody (NBP3-10866).

Blogs on CDP/CUTL1

There are no specific blogs for CDP/CUTL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDP/CUTL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CUX1