CDP/CUTL1 Antibody (2D10)

Images

 
Western Blot: CDP/CUTL1 Antibody (2D10) [H00001523-M02] - CUTL1 monoclonal antibody (M02), clone 2D10 Analysis of CUTL1 expression in Hela S3 NE.
Sandwich ELISA: CDP/CUTL1 Antibody (2D10) [H00001523-M02] - Detection limit for recombinant GST tagged CUTL1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDP/CUTL1 Antibody (2D10) Summary

Immunogen
CUTL1 (NP_001904.2, 521 a.a. - 620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Specificity
CUTL1 (2D10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CUX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDP/CUTL1 Antibody (2D10)

  • CASP
  • CCAAT displacement protein
  • CDP
  • CDP/Cux
  • CDPCCAAT displacement protein
  • COY1
  • cut (Drosophila)-like 1 (CCAAT displacement protein)
  • CUT
  • CUTL1
  • cut-like 1, CCAAT displacement protein (Drosophila)
  • cut-like homeobox 1
  • CUX
  • CUX1
  • FLJ31745
  • golgi integral membrane protein 6
  • GOLIM6
  • homeobox protein cut-like 1
  • Homeobox protein cux-1
  • Nbla10317
  • p100
  • p110
  • p200
  • p75
  • protein CASP
  • putative protein product of Nbla10317

Background

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB6638
Species: Hu, Mu, Rt
Applications: WB
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
H00001523-M02
Species: Hu
Applications: WB, ELISA

Publications for CDP/CUTL1 Antibody (H00001523-M02) (0)

There are no publications for CDP/CUTL1 Antibody (H00001523-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDP/CUTL1 Antibody (H00001523-M02) (0)

There are no reviews for CDP/CUTL1 Antibody (H00001523-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDP/CUTL1 Antibody (H00001523-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDP/CUTL1 Products

Bioinformatics Tool for CDP/CUTL1 Antibody (H00001523-M02)

Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (H00001523-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDP/CUTL1 Antibody (H00001523-M02)

Discover more about diseases related to CDP/CUTL1 Antibody (H00001523-M02).
 

Pathways for CDP/CUTL1 Antibody (H00001523-M02)

View related products by pathway.

PTMs for CDP/CUTL1 Antibody (H00001523-M02)

Learn more about PTMs related to CDP/CUTL1 Antibody (H00001523-M02).

Blogs on CDP/CUTL1

There are no specific blogs for CDP/CUTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDP/CUTL1 Antibody (2D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol CUX1
Entrez
OMIM
Uniprot