CDP/CUTL1 Antibody (2D10) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
CUTL1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI |
Specificity |
CUTL1 (2D10) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CUX1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CDP/CUTL1 Antibody (2D10)
Background
The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: WB, ELISA
Publications for CDP/CUTL1 Antibody (H00001523-M02) (0)
There are no publications for CDP/CUTL1 Antibody (H00001523-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CDP/CUTL1 Antibody (H00001523-M02) (0)
There are no reviews for CDP/CUTL1 Antibody (H00001523-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CDP/CUTL1 Antibody (H00001523-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CDP/CUTL1 Products
Bioinformatics Tool for CDP/CUTL1 Antibody (H00001523-M02)
Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (H00001523-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CDP/CUTL1 Antibody (H00001523-M02)
Discover more about diseases related to CDP/CUTL1 Antibody (H00001523-M02).
| | Pathways for CDP/CUTL1 Antibody (H00001523-M02)
View related products by pathway.
|
PTMs for CDP/CUTL1 Antibody (H00001523-M02)
Learn more about PTMs related to CDP/CUTL1 Antibody (H00001523-M02).
|
Blogs on CDP/CUTL1