Cdk9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody [NBP1-86808] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytoplasmic bodies.
Immunohistochemistry-Paraffin: Cdk9 Antibody [NBP1-86808] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdk9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cdk9 Protein (NBP1-86808PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cdk9 Antibody

  • C-2k
  • CDC2L4CTK1
  • CDC2-related kinase
  • Cell division cycle 2-like protein kinase 4
  • Cell division protein kinase 9
  • cyclin-dependent kinase 9 (CDC2-related kinase)
  • cyclin-dependent kinase 9
  • EC 2.7.11
  • EC 2.7.11.22
  • EC 2.7.11.23
  • PITALRE
  • serine/threonine protein kinase PITALRE
  • Serine/threonine-protein kinase PITALRE
  • TAK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000904-Q01
Species: Hu
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
NBP1-87592
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-06519
Species: Hu
Applications: WB, IHC-P, IP
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Cdk9 Antibody (NBP1-86808) (0)

There are no publications for Cdk9 Antibody (NBP1-86808).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk9 Antibody (NBP1-86808) (0)

There are no reviews for Cdk9 Antibody (NBP1-86808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cdk9 Antibody (NBP1-86808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdk9 Products

Bioinformatics Tool for Cdk9 Antibody (NBP1-86808)

Discover related pathways, diseases and genes to Cdk9 Antibody (NBP1-86808). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk9 Antibody (NBP1-86808)

Discover more about diseases related to Cdk9 Antibody (NBP1-86808).
 

Pathways for Cdk9 Antibody (NBP1-86808)

View related products by pathway.

PTMs for Cdk9 Antibody (NBP1-86808)

Learn more about PTMs related to Cdk9 Antibody (NBP1-86808).
 

Research Areas for Cdk9 Antibody (NBP1-86808)

Find related products by research area.

Blogs on Cdk9

There are no specific blogs for Cdk9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK9